Anti-VIP36 antibody (ab224227)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-VIP36 antibody
See all VIP36 primary antibodies -
Description
Rabbit polyclonal to VIP36 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Dog -
Immunogen
Recombinant fragment corresponding to Human VIP36 aa 49-193.
Sequence:GNSEHLKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKE GSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVF GSKDNFHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKD
Database link: Q12907 -
Positive control
- WB: VIP36 overexpression HEK-293T lysate. IHC-P: Human testis tissue.
-
General notes
Previously labelled as LMAN2.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.2
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab224227 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/100 - 1/250. Predicted molecular weight: 40 kDa. | |
IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Plays a role as an intracellular lectin in the early secretory pathway. Interacts with N-acetyl-D-galactosamine and high-mannose type glycans and may also bind to O-linked glycans. Involved in the transport and sorting of glycoproteins carrying high mannose-type glycans. -
Tissue specificity
Ubiquitous. -
Sequence similarities
Contains 1 L-type lectin-like domain. -
Cellular localization
Endoplasmic reticulum-Golgi intermediate compartment membrane. Golgi apparatus membrane. Endoplasmic reticulum membrane. - Information by UniProt
-
Database links
- Entrez Gene: 403938 Dog
- Entrez Gene: 10960 Human
- Entrez Gene: 66890 Mouse
- Omim: 609551 Human
- SwissProt: P49256 Dog
- SwissProt: Q12907 Human
- SwissProt: Q9DBH5 Mouse
- Unigene: 75864 Human
see all -
Alternative names
- C5orf8 antibody
- Glycoprotein GP36b antibody
- GP36B antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-VIP36 antibody (ab224227)
Paraffin-embedded human testis tissue stained for VIP36 using ab224227 at 1/50 dilution in immunohistochemical analysis.
-
All lanes : Anti-VIP36 antibody (ab224227) at 1/100 dilution
Lane 1 : Vector only transfected HEK293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) overexpressing VIP36 (co-expressed with a C terminal myc-DDK tag), cell lysate
Developed using the ECL technique.
Predicted band size: 40 kDa
Datasheets and documents
References
ab224227 has not yet been referenced specifically in any publications.