Overview

  • Product name

  • Description

    Rabbit polyclonal to VIP36
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Dog
  • Immunogen

    Recombinant fragment corresponding to Human VIP36 aa 49-193.
    Sequence:

    GNSEHLKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKE GSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVF GSKDNFHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKD


    Database link: Q12907

  • Positive control

    • WB: VIP36 overexpression HEK-293T lysate. IHC-P: Human testis tissue.
  • General notes

    Previously labelled as LMAN2.

Properties

Applications

Our Abpromise guarantee covers the use of ab224227 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 40 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Plays a role as an intracellular lectin in the early secretory pathway. Interacts with N-acetyl-D-galactosamine and high-mannose type glycans and may also bind to O-linked glycans. Involved in the transport and sorting of glycoproteins carrying high mannose-type glycans.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Contains 1 L-type lectin-like domain.
  • Cellular localization

    Endoplasmic reticulum-Golgi intermediate compartment membrane. Golgi apparatus membrane. Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • C5orf8 antibody
    • Glycoprotein GP36b antibody
    • GP36B antibody
    • Lectin mannose-binding 2 antibody
    • Lectin, mannose binding 2 antibody
    • LMAN 2 antibody
    • LMAN2 antibody
    • LMAN2_HUMAN antibody
    • Vesicular integral membrane protein VIP36 antibody
    • Vesicular integral-membrane protein 36 antibody
    • Vesicular integral-membrane protein VIP36 antibody
    • VIP36 antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for VIP36 using ab224227 at 1/50 dilution in immunohistochemical analysis.

  • All lanes : Anti-VIP36 antibody (ab224227) at 1/100 dilution

    Lane 1 : Vector only transfected HEK293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) overexpressing VIP36 (co-expressed with a C terminal myc-DDK tag), cell lysate

    Developed using the ECL technique.

    Predicted band size: 40 kDa

References

ab224227 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224227.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up