Anti-VIP36 antibody (ab224227)
Key features and details
- Rabbit polyclonal to VIP36
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-VIP36 antibody
See all VIP36 primary antibodies -
Description
Rabbit polyclonal to VIP36 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Dog
-
Immunogen
Recombinant fragment corresponding to Human VIP36 aa 49-193.
Sequence:GNSEHLKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKE GSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVF GSKDNFHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKD
Database link: Q12907 -
Positive control
- WB: VIP36 overexpression HEK-293T lysate. IHC-P: Human testis tissue.
-
General notes
Previously labelled as LMAN2.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab224227 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 40 kDa. | |
| IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Plays a role as an intracellular lectin in the early secretory pathway. Interacts with N-acetyl-D-galactosamine and high-mannose type glycans and may also bind to O-linked glycans. Involved in the transport and sorting of glycoproteins carrying high mannose-type glycans. -
Tissue specificity
Ubiquitous. -
Sequence similarities
Contains 1 L-type lectin-like domain. -
Cellular localization
Endoplasmic reticulum-Golgi intermediate compartment membrane. Golgi apparatus membrane. Endoplasmic reticulum membrane. - Information by UniProt
-
Database links
- Entrez Gene: 403938 Dog
- Entrez Gene: 10960 Human
- Entrez Gene: 66890 Mouse
- Omim: 609551 Human
- SwissProt: P49256 Dog
- SwissProt: Q12907 Human
- SwissProt: Q9DBH5 Mouse
- Unigene: 75864 Human
see all -
Alternative names
- C5orf8 antibody
- Glycoprotein GP36b antibody
- GP36B antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-VIP36 antibody (ab224227)Paraffin-embedded human skeletal muscle stained for VIP36 using ab224227 at 1/50 dilution in immunohistochemical analysis. Shows no positivity in myocytes as expected.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-VIP36 antibody (ab224227)Paraffin-embedded human testis stained for VIP36 using ab224227 at 1/50 dilution in immunohistochemical analysis. Shows moderate cytoplasmic positivity in cells of the seminiferous duct.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-VIP36 antibody (ab224227)Paraffin-embedded human lungs stained for VIP36 using ab224227 at 1/50 dilution in immunohistochemical analysis. Shows weak to moderate cytoplasmic positivity in macrophages.
-
Western blot - Anti-VIP36 antibody (ab224227)All lanes : Anti-VIP36 antibody (ab224227) at 1/100 dilution
Lane 1 : Vector only transfected HEK293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) overexpressing VIP36 (co-expressed with a C terminal myc-DDK tag), cell lysate
Developed using the ECL technique.
Predicted band size: 40 kDa
Protocols
Datasheets and documents
References (0)
ab224227 has not yet been referenced specifically in any publications.
