Overview

  • Product name

  • Description

    Rabbit polyclonal to Viperin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Pig, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human Viperin aa 100-330.
    Sequence:

    LPLEEAKRGLLLLKEAGMEKINFSGGEPFLQDRGEYLGKLVRFCKVELRL PSVSIVSNGSLIRERWFQNYGEYLDILAISCDSFDEEVNVLIGRGQGKKN HVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQ CLLIEGENCGEDALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKD SYLILDEYMRFLNCRKGRKDPSKSILDVGVE


    Database link: Q8WXG1

  • Positive control

    • Human brain lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab208286 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 3 µg/ml. Predicted molecular weight: 42 kDa.

Target

  • Function

    Involved in antiviral defense. May impair virus budding by disrupting lipid rafts at the plasma membrane, a feature which is essential for the budding process of many viruses. Acts through binding with and inactivating FPPS, an enzyme involved in synthesis of cholesterol, farnesylated and geranylated proteins, ubiquinones dolichol and heme. Plays a major role in the cell antiviral state induced by type I and type II interferon. Displays antiviral effect against HIV-1 virus, hepatitis C virus, human cytomegalovirus, and aphaviruses, but not vesiculovirus.
  • Sequence similarities

    Belongs to the RSAD2 family.
  • Cellular localization

    Endoplasmic reticulum membrane. Golgi apparatus. Probably associates with the cytosolic side of the endoplasmic reticulum. Infection with human cytomegalovirus (HCMV) causes relocation to the Golgi apparatus and to cytoplasmic vacuoles which also contain HCMV proteins glycoprotein B and pp28.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2510004L01Rik antibody
    • cig 33 antibody
    • CIG 5 antibody
    • cig-33 antibody
    • CIG-5 antibody
    • CIG33 antibody
    • CIG5 antibody
    • Cytomegalovirus induced gene 5 protein antibody
    • Cytomegalovirus-induced gene 5 protein antibody
    • endoplasmic reticulum-associated antibody
    • interferon-inducible antibody
    • Radical S adenosyl methionine domain containing 2 antibody
    • Radical S-adenosyl methionine domain-containing protein 2 antibody
    • RSAD 2 antibody
    • Rsad2 antibody
    • RSAD2_HUMAN antibody
    • RSDA-2 antibody
    • VIG 1 antibody
    • vig1 antibody
    • Viperin antibody
    • Virus inhibitory protein antibody
    • virus inhibitory protein endoplasmic reticulum associated interferon inducible antibody
    see all

Images

  • Anti-Viperin antibody (ab208286) at 3 µg/ml + Human brain lysate

    Predicted band size: 42 kDa

References

ab208286 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab208286.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up