Overview

  • Product name

  • Description

    Rabbit polyclonal to Visfatin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IP, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Pig
  • Immunogen

    Recombinant fragment corresponding to Human Visfatin aa 1-280.
    Sequence:

    MNPAAEAEFNILLATDSYKVTHYKQYPPNTSKVYSYFECREKKTENSKLR KVKYEETVFYGLQYILNKYLKGKVVTKEKIQEAKDVYKEHFQDDVFNEKG WNYILEKYDGHLPIEIKAVPEGFVIPRGNVLFTVENTDPECYWLTNWIET ILVQSWYPITVATNSREQKKILAKYLLETSGNLDGLEYKLHDFGYRGVSS QETAGIGASAHLVNFKGTDTVAGLALIKKYYGTKDPVPGYSVPAAEHSTI TAWGKDHEKDAFEHIVTQFSSVPVSVVSDS


    Database link: P43490

  • Positive control

    • IHC-P: Human liver and kidney tissue. IP: MCF7 whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab236091 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP 1/200 - 1/2000.
IHC-P 1/20 - 1/200.

Target

  • Function

    Catalyzes the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, an intermediate in the biosynthesis of NAD. It is the rate limiting component in the mammalian NAD biosynthesis pathway.
  • Tissue specificity

    Expressed in large amounts in bone marrow, liver tissue, and muscle. Also present in heart, placenta, lung, and kidney tissues.
  • Pathway

    Cofactor biosynthesis; NAD(+) biosynthesis; nicotinamide D-ribonucleotide from 5-phospho-alpha-D-ribose 1-diphosphate and nicotinamide: step 1/1.
  • Sequence similarities

    Belongs to the NAPRTase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1110035O14Rik antibody
    • AI314458 antibody
    • AI480535 antibody
    • DKFZP666B131 antibody
    • EC 2.4.2.12 antibody
    • MGC117256 antibody
    • NAmPRTase antibody
    • Nampt antibody
    • NAMPT_HUMAN antibody
    • Nicotinamide phosphoribosyltransferase antibody
    • PBEF 1 antibody
    • PBEF antibody
    • PBEF1 antibody
    • Pre B cell colony enhancing factor 1 antibody
    • Pre B cell colony enhancing factor antibody
    • Pre B cell enhancing factor antibody
    • Pre-B cell-enhancing factor antibody
    • Pre-B-cell colony-enhancing factor 1 antibody
    • VF antibody
    • Visfatin antibody
    see all

Images

  • Visfatin was immunoprecipitated from 0.5 mg MCF7 (human breast adenocarcinoma cell line) whole cell lysate with ab236091 at 1/200 dilution. 

    Lane 1: Control rabbit IgG IP in MCF7 whole cell lysate.

    Lane 2: ab236091 IP in MCF7 whole cell lysate.

    Lane 3: MCF7 whole cell lysate 10 μg (Input).

  • Paraffin-embedded human liver tissue stained for Visfatin using ab236091 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for Visfatin using ab236091 at 1/100 dilution in immunohistochemical analysis.

References

ab236091 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236091.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up