Overview

  • Product name
  • Description
    Rabbit polyclonal to Visfatin
  • Host species
    Rabbit
  • Specificity
    This antibody reacts with PBEF
  • Tested applications
    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human Visfatin aa 441-490 (C terminal).
    Sequence:

    VTLEEGKGDLEEYGQDLLHTVFKNGKVTKSYSFDEIRKNAQLNIELEAAH

  • Positive control
    • Jurkat whole cell lysate (ab7899) and human kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab58640 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 10 µg/ml.
WB Use a concentration of 1.25 µg/ml. Detects a band of approximately 54 kDa (predicted molecular weight: 54 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use a concentration of 4 - 8 µg/ml.

Target

  • Function
    Catalyzes the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, an intermediate in the biosynthesis of NAD. It is the rate limiting component in the mammalian NAD biosynthesis pathway.
  • Tissue specificity
    Expressed in large amounts in bone marrow, liver tissue, and muscle. Also present in heart, placenta, lung, and kidney tissues.
  • Pathway
    Cofactor biosynthesis; NAD(+) biosynthesis; nicotinamide D-ribonucleotide from 5-phospho-alpha-D-ribose 1-diphosphate and nicotinamide: step 1/1.
  • Sequence similarities
    Belongs to the NAPRTase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • 1110035O14Rik antibody
    • AI314458 antibody
    • AI480535 antibody
    • DKFZP666B131 antibody
    • EC 2.4.2.12 antibody
    • MGC117256 antibody
    • NAmPRTase antibody
    • Nampt antibody
    • NAMPT_HUMAN antibody
    • Nicotinamide phosphoribosyltransferase antibody
    • PBEF 1 antibody
    • PBEF antibody
    • PBEF1 antibody
    • Pre B cell colony enhancing factor 1 antibody
    • Pre B cell colony enhancing factor antibody
    • Pre B cell enhancing factor antibody
    • Pre-B cell-enhancing factor antibody
    • Pre-B-cell colony-enhancing factor 1 antibody
    • VF antibody
    • Visfatin antibody
    see all

Images

  • Anti-Visfatin antibody (ab58640) at 1.25 µg/ml + Jurkat cell lysate at 10 µg with 5% skim milk in PBS buffer

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 54 kDa
    Observed band size: 54 kDa



    Gel concentration: 12%
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human kidney tissue labelling Visfatin with ab58640 at 4-8µg/ml. Arrows indicate positively labelled epithelial cells of the renal tubules. Magnification: 400X.

  • ICC/IF image of ab58640 stained HepG2 cells. The cells were 4% formaldehyde (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab58640, 10µg/ml) overnight at +4°C. The secondary antibody (green) was for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

References

This product has been referenced in:
  • Zhang Q  et al. Overexpression of miR-182 inhibits ossification of ligamentum flavum cells by targeting NAMPT. Exp Cell Res 367:119-131 (2018). WB . Read more (PubMed: 29601800) »
  • Zhang J  et al. Extended wakefulness: compromised metabolics in and degeneration of locus ceruleus neurons. J Neurosci 34:4418-31 (2014). Mouse . Read more (PubMed: 24647961) »
See all 3 Publications for this product

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Answer

Thank you for your reply.

I have updated the address on the order, and it should arrive tomorrow. I look forward to receiving your protocol and hopefully resolving this issue.

Thanks again for your information. Please let me know if you have any questions. Have a great day!

Read More

Answer

Thank you for your call yesterday and for your email.

I'm sending a free of charge vial of ab58640 on the order ***, which should arrive tomorrow. This vial is from the same production batch as the first vial that you used in 2009 so I'm hopeful that it will work in a similar way.

I would like to follow-up with the lab so we can investigate the problem with the other lots that you have used. Could you send me some details of the protocols that you have used? In particular it would be helpful to know:

1) Species and tissue type tested with the antibody
2) Sample preparation (fixation, permeabilization, antigen retrieval)
3) Dilution/concentration of the antibody and incubation time
4) Blocking solution (for example, BSA or serum)
5) Detection system

Please keep me updated about the results using the new vial, and let me know if you have any questions or if there is anything else that we can do for you.

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up