Overview

  • Product name

    Anti-VISTA antibody [MM0741-29N17]
    See all VISTA primary antibodies
  • Description

    Mouse monoclonal [MM0741-29N17] to VISTA
  • Host species

    Mouse
  • Tested applications

    Suitable for: ELISA, ICC/IF, WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human VISTA aa 33-193.
    Sequence:

    FKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQT CSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSIT MRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYP SSSQDSENITA


    Database link: Q9H7M9

Properties

  • Form

    Lyophilised:Reconstitute the antibody with 500 uL sterile PBS and the final concentration is 200 ug/mL.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Constituent: 100% PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    The IgG fraction of culture supernatant was purified by Protein G affinity chromatography.
  • Clonality

    Monoclonal
  • Clone number

    MM0741-29N17
  • Isotype

    IgG2b
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab201565 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.
ICC/IF 1/50 - 1/200.
WB 1/1000 - 1/2000. Predicted molecular weight: 34 kDa.
Flow Cyt Use at an assay dependent concentration.

Target

  • Sequence similarities

    Contains 1 Ig-like (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • B7 H5 antibody
    • B7H5 antibody
    • C10orf54 antibody
    • chromosome 10 open reading frame 54 antibody
    • DD1alpha antibody
    • GI24 antibody
    • GI24_HUMAN antibody
    • PD-1H antibody
    • PDCD1 homolog antibody
    • Platelet receptor Gi24 antibody
    • PP2135 antibody
    • sisp 1 antibody
    • SISP1 antibody
    • stress induced secreted protein 1 antibody
    • UNQ730/PRO1412 antibody
    • V domain Ig suppressor of T cell activation antibody
    • V set domain containing immunoregulatory receptor antibody
    • V set immunoregulatory receptor antibody
    • V type immunoglobulin domain containing suppressor of T cell activation antibody
    • VISTA antibody
    see all

References

This product has been referenced in:

  • Mulati K  et al. VISTA expressed in tumour cells regulates T cell function. Br J Cancer 120:115-127 (2019). Read more (PubMed: 30382166) »
  • Dong Z  et al. EGFR may participate in immune evasion through regulation of B7-H5 expression in non-small cell lung carcinoma. Mol Med Rep 18:3769-3779 (2018). Read more (PubMed: 30106102) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201565.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up