Overview

  • Product name

    Anti-Vitamin D Binding protein antibody [C1]
    See all Vitamin D Binding protein primary antibodies
  • Description

    Mouse monoclonal [C1] to Vitamin D Binding protein
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human Vitamin D Binding protein aa 209-394. N-terminal tag (Expressed in E.coli).
    Sequence:

    LLLLTTMSNRVCSQYAAYGKEKSRMSHLIKLAQKVPTANLEDVLPLAEDL TEILSRCCKSTSEDCMARELPEHTLKICGNLSKKNSKFEECCYETTPMGI FMCSYFMPTAEPLQLPAIKLPTSKDLCGQSATQAMDQYTFELSRRTQVPE VFLSKVLDTTLKTLRECCDTQDSVSCFSTQSPLMKR


    Database link: P04276

  • Positive control

    • WB: Recombinant rat Vitamin D Binding protein; Rat serum. IHC-P: Rat pancreas tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab239733 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml.
IHC-P Use a concentration of 5 - 30 µg/ml.

Target

  • Function

    Multifunctional protein found in plasma, ascitic fluid, cerebrospinal fluid, and urine and on the surface of many cell types. In plasma, it carries the vitamin D sterols and prevents polymerization of actin by binding its monomers. DBP associates with membrane-bound immunoglobulin on the surface of B-lymphocytes and with IgG Fc receptor on the membranes of T-lymphocytes.
  • Sequence similarities

    Belongs to the ALB/AFP/VDB family.
    Contains 3 albumin domains.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • DBP antibody
    • DBP/GC antibody
    • GC antibody
    • Gc globulin antibody
    • Gc-globulin antibody
    • GRD3 antibody
    • Group specific component antibody
    • Group specific component vitamin D binding protein antibody
    • Group-specific component antibody
    • hDBP antibody
    • VDB antibody
    • VDBG antibody
    • VDBP antibody
    • Vitamin D binding alpha globulin antibody
    • Vitamin D-binding protein antibody
    • VTDB_HUMAN antibody
    see all

Images

  • Paraffin-embedded rat pancreas tissue stained for Vitamin D binding protein using ab239733 at 40 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Vitamin D Binding protein antibody [C1] (ab239733) at 3 µg/ml + Rat serum

    Secondary
    HRP-Linked Rabbit anti-Mouse IgG at 1/5000 dilution
  • Anti-Vitamin D Binding protein antibody [C1] (ab239733) at 5 µg/ml + Recombinant rat Vitamin D Binding protein

References

ab239733 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239733.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up