Overview

  • Product name

    Anti-Vitamin D Receptor antibody
    See all Vitamin D Receptor primary antibodies
  • Description

    Rabbit polyclonal to Vitamin D Receptor
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human Vitamin D Receptor aa 90-120 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    MKEFILTDEEVQRKREMILKRKEEEALKDSL


    Database link: P11473

  • Positive control

    • Rat brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab216514 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function

    Nuclear hormone receptor. Transcription factor that mediates the action of vitamin D3 by controlling the expression of hormone sensitive genes. Regulates transcription of hormone sensitive genes via its association with the WINAC complex, a chromatin-remodeling complex. Recruited to promoters via its interaction with the WINAC complex subunit BAZ1B/WSTF, which mediates the interaction with acetylated histones, an essential step for VDR-promoter association. Plays a central role in calcium homeostasis.
  • Involvement in disease

    Defects in VDR are the cause of rickets vitamin D-dependent type 2A (VDDR2A) [MIM:277440]. A disorder of vitamin D metabolism resulting in severe rickets, hypocalcemia and secondary hyperparathyroidism. Most patients have total alopecia in addition to rickets.
  • Sequence similarities

    Belongs to the nuclear hormone receptor family. NR1 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Domain

    Composed of three domains: a modulating N-terminal domain, a DNA-binding domain and a C-terminal ligand-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1 25 dihydroxyvitamin D3 receptor antibody
    • 1 antibody
    • 1,25 dihydroxyvitamin D3 receptor antibody
    • 1,25-@dihydroxyvitamin D3 receptor antibody
    • 25-dihydroxyvitamin D3 receptor antibody
    • Member 1 antibody
    • NR1I1 antibody
    • Nuclear receptor subfamily 1 group I member 1 antibody
    • PPP1R163 antibody
    • Protein phosphatase 1, regulatory subunit 163 antibody
    • VDR antibody
    • VDR_HUMAN antibody
    • Vitamin D (1,25- dihydroxyvitamin D3) receptor antibody
    • Vitamin D hormone receptor antibody
    • Vitamin D nuclear receptor variant 1 antibody
    • Vitamin D receptor antibody
    • Vitamin D3 receptor antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue labeling Vitamin D Receptor with ab216514 at 1/200 dilution, followed by secondary antibody detection and DAB staining.

References

ab216514 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216514.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up