Overview

  • Product name

    Anti-Vitronectin/S-Protein antibody
    See all Vitronectin/S-Protein primary antibodies
  • Description

    Sheep polyclonal to Vitronectin/S-Protein
  • Host species

    Sheep
  • Specificity

    ab211291 is specific for Vitronectin/S-Protein as demonstrated by immunoelectrophoresis. A single precipitin arc is observed with normal plasma, of identical mobility to that obtained with purified Vitronectin.

  • Tested applications

    Suitable for: IHC-P, Immunoelectrophoresismore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Full length native protein (purified) corresponding to Human Vitronectin/S-Protein aa 20-478. Purified from Human plasma. NP_000629.3.
    Sequence:

    DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFT MPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPE EEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKN GSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKT YLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRE RVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFEL LFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQ RFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDD YRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYW LGCPAPGHL


    Database link: P04004

  • Positive control

    • Human lung and Human liver tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Constituents: 0.87% Sodium chloride, 0.24% HEPES, 50% Glycerol
  • Concentration information loading...
  • Purity

    Ammonium Sulphate Precipitation
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab211291 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
Immunoelectrophoresis Use at an assay dependent concentration.

Target

  • Function

    Vitronectin is a cell adhesion and spreading factor found in serum and tissues. Vitronectin interact with glycosaminoglycans and proteoglycans. Is recognized by certain members of the integrin family and serves as a cell-to-substrate adhesion molecule. Inhibitor of the membrane-damaging effect of the terminal cytolytic complement pathway.
    Somatomedin-B is a growth hormone-dependent serum factor with protease-inhibiting activity.
  • Tissue specificity

    Plasma.
  • Sequence similarities

    Contains 4 hemopexin repeats.
    Contains 1 SMB (somatomedin-B) domain.
  • Domain

    The SMB domain mediates interaction with SERPINE1/PAI1. The heparin-binding domain mediates interaction with insulin.
  • Post-translational
    modifications

    Sulfated on 2 tyrosine residues.
    N- and O-glycosylated.
    Phosphorylation on Thr-69 and Thr-76 favors cell adhesion and spreading.
    It has been suggested that the active SMB domain may be permitted considerable disulfide bond heterogeneity or variability, thus two alternate disulfide patterns based on 3D structures are described with 1 disulfide bond conserved in both.
    Phosphorylation sites are present in the extracellular medium.
  • Cellular localization

    Secreted, extracellular space.
  • Information by UniProt
  • Database links

  • Alternative names

    • Complement S Protein antibody
    • Epibolin antibody
    • S Protein antibody
    • S-protein antibody
    • Serum Spreading Factor antibody
    • Serum-spreading factor antibody
    • Somatomedin B antibody
    • Somatomedin-B antibody
    • V75 antibody
    • Vitronectin antibody
    • Vitronectin V10 subunit antibody
    • Vitronectin V65 subunit antibody
    • VN antibody
    • VNT antibody
    • VTN antibody
    • VTNC_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human liver tissue labeling Vitronectin/S-Protein with ab211291 at 5 μg/ml dilution.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human lung tissue labeling Vitronectin/S-Protein with ab211291 at 5 μg/ml dilution.

References

ab211291 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211291.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up