Anti-Vitronectin/S-Protein antibody (ab235987)
Key features and details
- Rabbit polyclonal to Vitronectin/S-Protein
- Suitable for: IHC-P, IP
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-Vitronectin/S-Protein antibody
See all Vitronectin/S-Protein primary antibodies -
Description
Rabbit polyclonal to Vitronectin/S-Protein -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, IPmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Recombinant fragment corresponding to Human Vitronectin/S-Protein aa 364-478.
Sequence:SLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLG ANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPR SIAQYWLGCPAPGHL
Database link: P04004 -
Positive control
- IHC-P: Human small intestine and placenta tissues. IP: NIH/3T3 whole cell lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab235987 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/20 - 1/200. | |
IP | 1/200 - 1/2000. |
Target
-
Function
Vitronectin is a cell adhesion and spreading factor found in serum and tissues. Vitronectin interact with glycosaminoglycans and proteoglycans. Is recognized by certain members of the integrin family and serves as a cell-to-substrate adhesion molecule. Inhibitor of the membrane-damaging effect of the terminal cytolytic complement pathway.
Somatomedin-B is a growth hormone-dependent serum factor with protease-inhibiting activity. -
Tissue specificity
Plasma. -
Sequence similarities
Contains 4 hemopexin repeats.
Contains 1 SMB (somatomedin-B) domain. -
Domain
The SMB domain mediates interaction with SERPINE1/PAI1. The heparin-binding domain mediates interaction with insulin. -
Post-translational
modificationsSulfated on 2 tyrosine residues.
N- and O-glycosylated.
Phosphorylation on Thr-69 and Thr-76 favors cell adhesion and spreading.
It has been suggested that the active SMB domain may be permitted considerable disulfide bond heterogeneity or variability, thus two alternate disulfide patterns based on 3D structures are described with 1 disulfide bond conserved in both.
Phosphorylation sites are present in the extracellular medium. -
Cellular localization
Secreted, extracellular space. - Information by UniProt
-
Database links
- Entrez Gene: 7448 Human
- Entrez Gene: 22370 Mouse
- Omim: 193190 Human
- SwissProt: P04004 Human
- SwissProt: P29788 Mouse
- Unigene: 2257 Human
-
Alternative names
- Complement S Protein antibody
- Epibolin antibody
- S Protein antibody
see all
Images
-
Vitronectin/S-Protein was immunoprecipitated from 500 µg NIH/3T3 (Mouse embryo fibroblast cell line) whole cell lysate with ab235987.
Lane 1: Rabbit control IgG IP in NIH/3T3 whole cell lysate.
Lane 2: ab235987 IP in NIH/3T3 whole cell lysate.
Lane 3: NIH/3T3 whole cell lysate 10 µg (Input).
For western blotting, an HRP-conjugated Protein G antibody was used as the secondary antibody at 1/2000 dilution.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Vitronectin/S-Protein antibody (ab235987)
Paraffin-embedded human small intestine tissue stained for Vitronectin/S-Protein using ab235987 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Vitronectin/S-Protein antibody (ab235987)
Paraffin-embedded human placenta tissue stained for Vitronectin/S-Protein using ab235987 at 1/100 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab235987 has not yet been referenced specifically in any publications.