Overview

  • Product name

    Anti-VMO1 antibody
  • Description

    Rabbit polyclonal to VMO1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    antigen sequence: QTDGRNGYTAVIEVTSGGPWGDWAWPEMCPDGFFASGFSLKVEPPQGIPG DDTALNGIRLHCARGNVLGNTHVVESQSGSWGEWSEPL corresponding to amino acids 25-112 of Human VMO1.

  • Positive control

    • Human breast tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab126510 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • ab126510, at 1/50 dilution, staining VMO1 in paraffin-embedded Human breast by Immunohistochemistry.

References

ab126510 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab126510.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up