Overview

  • Product name

    Anti-VN1R2 antibody
  • Description

    Rabbit polyclonal to VN1R2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human VN1R2 aa 115-170.
    Sequence:

    YFRGYKPRSTDLILRHLTVADSLVILSKRIPETMATFGLKHFDNYFGCKF LLYAHR


    Database link: Q8NFZ6

  • Positive control

    • WB: HeLa, A549 and HepG2 whole cell lysates. ICC/IF: MCF7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab237679 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 44 kDa.

Target

  • Information by UniProt
  • Database links

  • Alternative names

    • G-protein coupled receptor GPCR25 antibody
    • hGPCR25 antibody
    • pheromone receptor antibody
    • V1r like receptor 2 antibody
    • V1R-like 2 antibody
    • V1r-like receptor 2 antibody
    • V1RL2 antibody
    • VN1R2 antibody
    • VN1R2_HUMAN antibody
    • vomeronasal 1 receptor 2 antibody
    • Vomeronasal type 1 receptor 2 antibody
    • Vomeronasal type-1 receptor 2 antibody
    see all

Images

  • All lanes : Anti-VN1R2 antibody (ab237679) at 1/1000 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 3 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 44 kDa

  • MCF7 (human breast adenocarcinoma cell line) cells stained for VN1R2 (green) using ab237679 at 1/100 dilution in ICC/IF. Secondary antibody is Alexa Fluor® 488-congugated Goat Anti-Rabbit IgG (H+L).

References

ab237679 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237679.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up