Overview

  • Product name

    Anti-VNN1/Vanin-1 antibody
    See all VNN1/Vanin-1 primary antibodies
  • Description

    Rabbit polyclonal to VNN1/Vanin-1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human VNN1/Vanin-1 aa 304-497. (BC096268).
    Sequence:

    LDSHPSHSAVVNWTSYASSIEALSSGNKEFKGTVFFDEFTFVKLTGVAGN YTVCQKDLCCHLSYKMSENIPNEVYALGAFDGLHTVEGRYYLQICTLLKC KTTNLNTCGDSAETASTRFEMFSLSGTFGTQYVFPEVLLSENQLAPGEFQ VSTDGRLFSLKPTSGPVLTVTLFGRLYEKDWASNASSGLTAQAR


    Database link: O95497

  • Positive control

    • HepG2 lysate; Human fetal spleen tissue.
  • General notes

     This product was previously labelled as VNN1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab205912 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 57 kDa.
IHC-P 1/100 - 1/500.

Target

  • Function

    Amidohydrolase that hydrolyzes specifically one of the carboamide linkages in D-pantetheine thus recycling pantothenic acid (vitamin B5) and releasing cysteamine.
  • Tissue specificity

    Widely expressed with higher expression in spleen, kidney and blood. Overexpressed in lesional psoriatic skin.
  • Sequence similarities

    Belongs to the CN hydrolase family. BTD/VNN subfamily.
    Contains 1 CN hydrolase domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • HDLCQ8 antibody
    • High density lipoprotein cholesterol level quantitative trait locus 8, included antibody
    • Pantetheinase antibody
    • Pantetheine hydrolase antibody
    • Tiff66 antibody
    • V-1 antibody
    • Vanin 1 antibody
    • Vanin-1 antibody
    • Vannin 1 antibody
    • Vascular non inflammatory molecule 1 antibody
    • Vascular non-inflammatory molecule 1 antibody
    • VNN 1 antibody
    • VNN1 antibody
    • VNN1_HUMAN antibody
    see all

Images

  • Anti-VNN1/Vanin-1 antibody (ab205912) at 1/500 dilution + HepG2 lysate

    Predicted band size: 57 kDa

  • Immunohistochemical analysis of formalin-fixed,, paraffin-embedded Human fetal spleen tissue labeling VNN1/Vanin-1 with ab205912 at 1/100 dilution.

References

This product has been referenced in:

  • Chai CY  et al. VNN1 overexpression is associated with poor response to preoperative chemoradiotherapy and adverse prognosis in patients with rectal cancers. Am J Transl Res 8:4455-4463 (2016). IHC ; Human . Read more (PubMed: 27830030) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab205912.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up