Anti-VNN1/Vanin-1 antibody (ab231056)
Key features and details
- Rabbit polyclonal to VNN1/Vanin-1
- Suitable for: WB, IHC-P
- Reacts with: Rat
- Isotype: IgG
Overview
-
Product name
Anti-VNN1/Vanin-1 antibody
See all VNN1/Vanin-1 primary antibodies -
Description
Rabbit polyclonal to VNN1/Vanin-1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Rat
Predicted to work with: Mouse -
Immunogen
Recombinant fragment (His-T7-tag) corresponding to Rat VNN1/Vanin-1 aa 22-328. (Expressed in E.coli).
Sequence:SSLDTFLAAVYEHAVILPKVTLLPVSHSEALALMNQNLDLLEGAILSAAK QGAHIIVTPEDGIYGVQFTRDTIYPYLEDIPDPQVNWIPCDNPERFGSTP VQERLSCLAKNNSIYVVANMGDKKPCNTSDSHCPPDGRFQYNTDVVFDSR GKLVARYHKQNLFMGEEQFNAPPEPEVVTFDTPFGKFGIFTCFDILFHDP AVTLVTEFQVDTILFPTAWMDVLPHLAAIEFHSAWAIGMGVNFLAANLHI PLRRMTGSGIYAPDSPRAFHYDRKTQEGKLLLAQLDSHPSHSPVNWTSYA SSVEAPP
Database link: Q4KLZ0 -
Positive control
- IHC-P: Rat liver tissue. WB: Rat serum; Recombinant rat VNN1/Vanin-1 protein.
-
General notes
This product was previously labelled as VNN1
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab231056 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab231056 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 57 kDa. | |
IHC-P | Use a concentration of 5 - 20 µg/ml. |
Target
-
Function
Amidohydrolase that hydrolyzes specifically one of the carboamide linkages in D-pantetheine thus recycling pantothenic acid (vitamin B5) and releasing cysteamine. -
Tissue specificity
Widely expressed with higher expression in spleen, kidney and blood. Overexpressed in lesional psoriatic skin. -
Sequence similarities
Belongs to the CN hydrolase family. BTD/VNN subfamily.
Contains 1 CN hydrolase domain. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 22361 Mouse
- Entrez Gene: 29142 Rat
- SwissProt: Q9Z0K8 Mouse
- Unigene: 27154 Mouse
-
Alternative names
- HDLCQ8 antibody
- High density lipoprotein cholesterol level quantitative trait locus 8, included antibody
- Pantetheinase antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-VNN1/Vanin-1 antibody (ab231056)
Formalin-fixed, paraffin-embedded rat liver tissue stained for VNN1/Vanin-1 using ab231056 at 20 µg/ml in immunohistochemical analysis, followed by DAB staining.
-
Anti-VNN1/Vanin-1 antibody (ab231056) at 1 µg/ml + Rat serum
Predicted band size: 57 kDa -
Anti-VNN1/Vanin-1 antibody (ab231056) at 2 µg/ml + Recombinant rat VNN1/Vanin-1 protein
Predicted band size: 57 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab231056 has not yet been referenced specifically in any publications.