Overview

  • Product name

    Anti-VNN1/Vanin-1 antibody
    See all VNN1/Vanin-1 primary antibodies
  • Description

    Rabbit polyclonal to VNN1/Vanin-1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human VNN1/Vanin-1 aa 36-223. (Expressed in E.coli).
    Sequence:

    LPNATLTPVSREEALALMNRNLDILEGAITSAADQGAHIIVTPEDAIYGW NFNRDSLYPYLEDIPDPEVNWIPCNNRNRFGQTPVQERLSCLAKNNSIYV VANIGDKKPCDTSDPQCPPDGRYQYNTDVVFDSQGKLVARYHKQNLFMGE NQFNVPKEPEIVTFNTTFGSFGIFTCFDILFHDPAVTL


    Database link: O95497

  • Positive control

    • WB: Mouse kidney and spleen lysates; PC-3 and BXPC-3 cell lysates; Recombinant human VNN1/Vanin-1 protein. IHC-P: Human breast cancer, kidney and stomach cancer tissues. ICC/IF: PC-3 cells.
  • General notes

     This product was previously labelled as VNN1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab233105 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 57 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.
ICC/IF Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Amidohydrolase that hydrolyzes specifically one of the carboamide linkages in D-pantetheine thus recycling pantothenic acid (vitamin B5) and releasing cysteamine.
  • Tissue specificity

    Widely expressed with higher expression in spleen, kidney and blood. Overexpressed in lesional psoriatic skin.
  • Sequence similarities

    Belongs to the CN hydrolase family. BTD/VNN subfamily.
    Contains 1 CN hydrolase domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • HDLCQ8 antibody
    • High density lipoprotein cholesterol level quantitative trait locus 8, included antibody
    • Pantetheinase antibody
    • Pantetheine hydrolase antibody
    • Tiff66 antibody
    • V-1 antibody
    • Vanin 1 antibody
    • Vanin-1 antibody
    • Vannin 1 antibody
    • Vascular non inflammatory molecule 1 antibody
    • Vascular non-inflammatory molecule 1 antibody
    • VNN 1 antibody
    • VNN1 antibody
    • VNN1_HUMAN antibody
    see all

Images

  • All lanes : Anti-VNN1/Vanin-1 antibody (ab233105) at 3 µg/ml

    Lane 1 : Mouse kidney lysate
    Lane 2 : Mouse spleen lysate
    Lane 3 : BxPC-3 (Human pancreas adenocarcinoma cell line) cell lysate
    Lane 4 : PC-3 (human prostate adenocarcinoma cell line) cell lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 57 kDa

  • Paraffin-embedded human stomach cancer tissue stained for VNN1/Vanin-1 using ab233105 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human kidney tissue stained for VNN1/Vanin-1 using ab233105 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human breast cancer tissue stained for VNN1/Vanin-1 using ab233105 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • PC-3 (human prostate adenocarcinoma cell line) cells stained for VNN1/Vanin-1 using ab233105 at 10 ug/ml in ICC/IF. followed by FITC staining.

  • Anti-VNN1/Vanin-1 antibody (ab233105) at 3 µg/ml + Recombinant human VNN1/Vanin-1 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 57 kDa

References

ab233105 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233105.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up