Anti-Von Hippel Lindau/VHL antibody [OTI1E1] (ab140989)
Key features and details
- Mouse monoclonal [OTI1E1] to Von Hippel Lindau/VHL
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG2b
Overview
-
Product name
Anti-Von Hippel Lindau/VHL antibody [OTI1E1]
See all Von Hippel Lindau/VHL primary antibodies -
Description
Mouse monoclonal [OTI1E1] to Von Hippel Lindau/VHL -
Host species
Mouse -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human Von Hippel Lindau/VHL aa 1-213. Produced in HEK-293T cells (NP_000542).
Sequence:MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGA EEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPT LPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFAN ITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLER LTQERIAHQRMGD
Database link: P40337 -
Positive control
- WB: Recombinant Human Von Hippel Lindau/VHL protein (ab82240), HEK-293T cell lysate transfected with pCMV6-ENTRY Von Hippel Lindau/VHL cDNA. IHC-P: Human colon carcinoma, ovary adenocarcinoma, pancreas, endometrium adenocarcinoma, lung carcinoma, endometrium and bladder tissue.
-
General notes
Clone OTI1E1 (formerly 1E1).
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 1% BSA, 50% Glycerol -
Concentration information loading...
-
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant. -
Clonality
Monoclonal -
Clone number
OTI1E1 -
Isotype
IgG2b -
Research areas
Associated products
-
Alternative Versions
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab140989 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/4000. Predicted molecular weight: 24 kDa. | |
IHC-P | 1/150. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Involved in the ubiquitination and subsequent proteasomal degradation via the von Hippel-Lindau ubiquitination complex. Seems to act as target recruitment subunit in the E3 ubiquitin ligase complex and recruits hydroxylated hypoxia-inducible factor (HIF) under normoxic conditions. Involved in transcriptional repression through interaction with HIF1A, HIF1AN and histone deacetylases. -
Tissue specificity
Expressed in the adult and fetal brain and kidney. -
Pathway
Protein modification; protein ubiquitination. -
Involvement in disease
Defects in VHL are a cause of susceptibility to pheochromocytoma (PCC) [MIM:171300]. A catecholamine-producing tumor of chromaffin tissue of the adrenal medulla or sympathetic paraganglia. The cardinal symptom, reflecting the increased secretion of epinephrine and norepinephrine, is hypertension, which may be persistent or intermittent.
Defects in VHL are the cause of von Hippel-Lindau disease (VHLD) [MIM:193300]. VHLD is a dominantly inherited familial cancer syndrome characterized by the development of retinal angiomatosis, cerebellar and spinal hemangioblastoma, renal cell carcinoma (RCC), phaeochromocytoma and pancreatic tumors. VHL type 1 is without pheochromocytoma, type 2 is with pheochromocytoma. VHL type 2 is further subdivided into types 2A (pheochromocytoma, retinal angioma, and hemangioblastomas without renal cell carcinoma and pancreatic cyst) and 2B (pheochromocytoma, retinal angioma, and hemangioblastomas with renal cell carcinoma and pancreatic cyst). VHL type 2C refers to patients with isolated pheochromocytoma without hemangioblastoma or renal cell carcinoma. The estimated incidence is 3/100000 births per year and penetrance is 97% by age 60 years.
Defects in VHL are the cause of erythrocytosis familial type 2 (ECYT2) [MIM:263400]; also called VHL-dependent polycythemia or Chuvash type polycythemia. ECYT2 is an autosomal recessive disorder characterized by an increase in serum red blood cell mass, hypersensitivity of erythroid progenitors to erythropoietin, increased erythropoietin serum levels, and normal oxygen affinity. Patients with ECYT2 carry a high risk for peripheral thrombosis and cerebrovascular events.
Defects in VHL are a cause of renal cell carcinoma (RCC) [MIM:144700]. Renal cell carcinoma is a heterogeneous group of sporadic or hereditary carcinoma derived from cells of the proximal renal tubular epithelium. It is subclassified into clear cell renal carcinoma (non-papillary carcinoma), papillary renal cell carcinoma, chromophobe renal cell carcinoma, collecting duct carcinoma with medullary carcinoma of the kidney, and unclassified renal cell carcinoma. -
Domain
The Elongin BC complex binding domain is also known as BC-box with the consensus [APST]-L-x(3)-C-x(3)-[AILV]. -
Cellular localization
Cytoplasm. Membrane. Nucleus. Found predominantly in the cytoplasm and with less amounts nuclear or membrane-associated and Cytoplasm. Nucleus. Equally distributed between the nucleus and the cytoplasm but not membrane-associated. - Information by UniProt
-
Database links
- Entrez Gene: 7428 Human
- Omim: 608537 Human
- SwissProt: P40337 Human
- Unigene: 517792 Human
- Unigene: 607789 Human
-
Alternative names
- Elongin binding protein antibody
- G7 protein antibody
- HRCA 1 antibody
see all
Images
-
All lanes : Anti-Von Hippel Lindau/VHL antibody [OTI1E1] (ab140989) at 1/4000 dilution
Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control cDNA
Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY Von Hippel Lindau cDNA
Lysates/proteins at 5 µg per lane.
Predicted band size: 24 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Von Hippel Lindau/VHL antibody [OTI1E1] (ab140989)
Paraffin-embedded human colon adenocarcinoma tissue stained for Von Hippel Lindau/VHL using ab140989 at 1/150 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Von Hippel Lindau/VHL antibody [OTI1E1] (ab140989)
Paraffin-embedded human lung carcinoma tissue stained for Von Hippel Lindau/VHL using ab140989 at 1/150 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Von Hippel Lindau/VHL antibody [OTI1E1] (ab140989)
Paraffin-embedded human ovary adenocarcinoma tissue stained for Von Hippel Lindau/VHL using ab140989 at 1/150 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Von Hippel Lindau/VHL antibody [OTI1E1] (ab140989)
Paraffin-embedded human pancreas tissue stained for Von Hippel Lindau/VHL using ab140989 at 1/150 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Von Hippel Lindau/VHL antibody [OTI1E1] (ab140989)
Paraffin-embedded human endometrium tissue stained for Von Hippel Lindau/VHL using ab140989 at 1/150 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Von Hippel Lindau/VHL antibody [OTI1E1] (ab140989)
Paraffin-embedded human endometrium adenocarcinoma tissue stained for Von Hippel Lindau/VHL using ab140989 at 1/150 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Von Hippel Lindau/VHL antibody [OTI1E1] (ab140989)
Paraffin-embedded human bladder tissue stained for Von Hippel Lindau/VHL using ab140989 at 1/150 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (7)
ab140989 has been referenced in 7 publications.
- Xi J et al. miR-155 inhibition represents a potential valuable regulator in mitigating myocardial hypoxia/reoxygenation injury through targeting BAG5 and MAPK/JNK signaling. Mol Med Rep 21:1011-1020 (2020). PubMed: 31922242
- Sun J et al. Downregulation of miR-21 inhibits the malignant phenotype of pancreatic cancer cells by targeting VHL. Onco Targets Ther 12:7215-7226 (2019). PubMed: 31564905
- Jiang P et al. FUBP1 promotes neuroblastoma proliferation via enhancing glycolysis-a new possible marker of malignancy for neuroblastoma. J Exp Clin Cancer Res 38:400 (2019). PubMed: 31511046
- Hu J et al. Establishment of xenografts of urological cancers on chicken chorioallantoic membrane (CAM) to study metastasis. Precis Clin Med 2:140-151 (2019). PubMed: 31598385
- Gao YH et al. VHL deficiency augments anthracycline sensitivity of clear cell renal cell carcinomas by down-regulating ALDH2. Nat Commun 8:15337 (2017). IHC . PubMed: 28643803
- Shell J et al. SomaticVHLMutation in a Patient With MEN1-Associated Metastatic Pancreatic Neuroendocrine Tumor Responding to Sunitinib Treatment: A Case Report. J Endocr Soc 1:1124-1134 (2017). PubMed: 29264567
- Zhao Z et al. Synergy between von Hippel-Lindau and P53 contributes to chemosensitivity of clear cell renal cell carcinoma. Mol Med Rep 14:2785-90 (2016). PubMed: 27485825