Overview

  • Product name

  • Description

    Mouse polyclonal to VPAC2
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human VPAC2 aa 24-126. NP_003373.
    Sequence:

    ECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWRPANVGETVTV PCPKVFSNFYSKAGNISKNCTSDGWSETFPDFVDACGYSDPEDESKITFY ILV


    Database link: P41587

  • Positive control

    • U-2 OS cell lysate; recombinant Human VPAC2 protein fragment (immunogen).

Properties

Applications

Our Abpromise guarantee covers the use of ab194383 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2500. Predicted molecular weight: 49 kDa.

Use at 1/500 - 1/1000 dilution for cell/tissue lysates and mammalian overexpressed lysate, or at 1/1000 - 1/2500 for recombinant protein.

Target

  • Function

    This is a receptor for VIP as well as PACAP-38 and -27, the activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Can be coupled to phospholipase C.
  • Tissue specificity

    Expressed in CD4+ T-cells, but not in CD8+ T-cells. Expressed in the T-cell lines Jurkat, PEER, MOLT-4, HSB, YT and Tsup-1, but not in the T-cell lines HARRIS and HUT 78.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 2 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Helodermin-preferring VIP receptor antibody
    • PACAP type III receptor antibody
    • PACAP-R-3 antibody
    • PACAP-R3 antibody
    • Pituitary adenylate cyclase-activating polypeptide type III receptor antibody
    • Vasoactive intestinal polypeptide receptor 2 antibody
    • VIP Receptor 2 antibody
    • VIP-R-2 antibody
    • Vipr2 antibody
    • VIPR2_HUMAN antibody
    • VPAC2 receptor antibody
    see all

Images

  • Anti-VPAC2 antibody (ab194383) at 1/1000 dilution + recombinant VPAC2 protein fragment (immunogen) at 0.2 µg

    Predicted band size: 49 kDa



    Predicted MWt of immunogen: 37.44 KDa.

  • Anti-VPAC2 antibody (ab194383) at 1/500 dilution + U-2 OS cell lysate at 50 µg

    Predicted band size: 49 kDa

References

ab194383 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194383.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up