Overview

  • Product name

  • Description

    Rabbit polyclonal to VPS16
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant fragment corresponding to Human VPS16 aa 7-89.
    Sequence:

    NWNPLGDSAFYRKYELYSMDWDLKEELRDCLVAAAPYGGPIALLRNPWRK EKAASVRPVLDIYSASGMPLASLLWKSGPVVSL


    Database link: Q9H269

  • Positive control

    • WB: Rat lung tissue lysate. IHC-P: Human lung and brain tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235098 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000.

Target

  • Function

    May play a role in vesicle-mediated protein trafficking to lysosomal compartments and in membrane docking/fusion reactions of late endosomes/lysosomes.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the VPS16 family.
  • Cellular localization

    Late endosome membrane. Lysosome membrane. Cytoplasmic, peripheral membrane protein associated with late endosomes/lysosomes.
  • Information by UniProt
  • Database links

  • Alternative names

    • HGNC:14584 antibody
    • hVPS16 antibody
    • mVPS16 antibody
    • RP11 12M19.2 antibody
    • Vacuolar protein sorting 16 (yeast) antibody
    • Vacuolar protein sorting 16 (Yeast), isoform CRA_a antibody
    • Vacuolar protein sorting 16 antibody
    • Vacuolar protein sorting 16 homolog (S. cerevisiae) antibody
    • vacuolar protein sorting associated protein 16 homolog antibody
    • Vacuolar protein sorting protein 16 antibody
    • Vacuolar protein sorting-associated protein 16 homolog antibody
    • VPS16 antibody
    • VPS16_HUMAN antibody
    • VPS16A antibody
    see all

Images

  • Anti-VPS16 antibody (ab235098) at 1/500 dilution + Rat lung tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution
  • Paraffin-embedded human lung tissue stained for VPS16 with ab235098 at 1/100 dilution) in immunohistochemical analysis.

  • Paraffin-embedded human brain tissue stained for VPS16 with ab235098 at 1/100 dilution in immunohistochemical analysis.

References

ab235098 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235098.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up