Overview

  • Product name

    Anti-VPS26B antibody
  • Description

    Rabbit polyclonal to VPS26B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Xenopus laevis, Orangutan, Xenopus tropicalis
  • Immunogen

    Recombinant full length protein corresponding to Human VPS26B aa 1-336.
    Sequence:

    MSFFGFGQSVEVEILLNDAESRKRAEHKTEDGKKEKYFLFYDGETVSGKV SLALKNPNKRLEHQGIKIEFIGQIELYYDRGNHHEFVSLVKDLARPGEIT QSQAFDFEFTHVEKPYESYTGQNVKLRYFLRATISRRLNDVVKEMDIVVH TLSTYPELNSSIKMEVGIEDCLHIEFEYNKSKYHLKDVIVGKIYFLLVRI KIKHMEIDIIKRETTGTGPNVYHENDTIAKYEIMDGAPVRGESIPIRLFL AGYELTPTMRDINKKFSVRYYLNLVLIDEEERRYFKQQEVVLWRKGDIVR KSMSHQAAIASQRFEGTTSLGEVRTPSQLSDNNCRQ


    Database link: Q4G0F5

  • Positive control

    • WB: Mouse brain tissue lysate. IHC-P: Human colon cancer tissue. ICC/IF: PC-3 cells.
  • General notes

     This product was previously labelled as VP26B

     

Properties

Applications

Our Abpromise guarantee covers the use of ab236966 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Acts as component of the retromer cargo-selective complex (CSC). The CSC is believed to be the core functional component of retromer or respective retromer complex variants acting to prevent missorting of selected transmembrane cargo proteins into the lysosomal degradation pathway. The recruitment of the CSC to the endosomal membrane involves RAB7A and SNX3. The SNX-BAR retromer mediates retrograde transport of cargo proteins from endosomes to the trans-Golgi network (TGN) and is involved in endosome-to-plasma membrane transport for cargo protein recycling. The SNX3-retromer mediates the retrograde transport of WLS distinct from the SNX-BAR retromer pathway. The SNX27-retromer is believed to be involved in endosome-to-plasma membrane trafficking and recycling of a broad spectrum of cargo proteins. The CSC seems to act as recruitment hub for other proteins, such as the WASH complex and TBC1D5. May be involved in retrograde transport of SORT1 but not of IGF2R. Acts redundantly with VSP26A in SNX-27 mediated endocytic recycling of SLC2A1/GLUT1.
  • Sequence similarities

    Belongs to the VPS26 family.
  • Cellular localization

    Cytoplasm. Membrane. Early endosome. Late endosome. Localizes to early and late endosomal structures (By similarity).
  • Information by UniProt
  • Database links

  • Alternative names

    • Pep8b antibody
    • Vacuolar protein sorting 26 homolog B (S. pombe) antibody
    • Vacuolar protein sorting 26 homolog B (yeast) antibody
    • Vacuolar protein sorting-associated protein 26B antibody
    • Vesicle protein sorting 26B antibody
    • VP26B_HUMAN antibody
    • VPS26B antibody
    see all

Images

  • Anti-VPS26B antibody (ab236966) at 1/500 dilution + Mouse brain tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution
  • Paraffin-embedded human colon cancer tissue stained for VPS26B using ab236966 at 1/100 dilution in immunohistochemical analysis.

  • PC-3 (human prostate adenocarcinoma cell line) cells stained for VPS26B (Green) using ab236966 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG (H+L) secondary antibody.

References

ab236966 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236966.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up