Overview

  • Product name

  • Description

    Rabbit polyclonal to VPS33B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human VPS33B aa 348-617.
    Sequence:

    CESIMKKKTKQDFQELIKTEHALLEGFNIRESTSYIEEHIDRQVSPIESL RLMCLLSITENGLIPKDYRSLKTQYLQSYGPEHLLTFSNLRRAGLLTEQA PGDTLTAVESKVSKLVTDKAAGKITDAFSSLAKRSNFRAISKKLNLIPRV DGEYDLKVPRDMAYVFGGAYVPLSCRIIEQVLERRSWQGLDEVVRLLNCS DFAFTDMTKEDKASSESLRLILVVFLGGCTFSEISALRFLGREKGYRFIF LTTAVTNSARLMEAMSEVKA


    Database link: Q9H267

  • Positive control

    • WB: HeLa and A549 whole cell lysates. IHC-P: Human testis and brain tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab234799 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 71 kDa.
IHC-P 1/20 - 1/200.

Target

  • Relevance

    VPS33B belongs to the STXBP/unc-18/SEC1 family. It may play a role in vesicle-mediated protein trafficking to lysosomal compartments and in membrane docking/fusion reactions of late endosomes/lysosomes. VPS33B is ubiquitous; highly expressed in testis and low expression in the lung. Defects in VPS33B are the cause of arthrogryposis-renal dysfunction-cholestasis syndrome (ARC) [MIM:208085]. ARC is an autosomal recessive multisystem disorder, characterized by neurogenic arthrogryposis multiplex congenita, renal tubular dysfunction and neonatal cholestasis with bile duct hypoplasia and low gamma glutamyl transpeptidase activity. Platelet dysfunction is common.
  • Cellular localization

    Late endosome membrane; Peripheral membrane protein; Cytoplasmic side. Lysosome membrane; Peripheral membrane protein; Cytoplasmic side. Note: Cytoplasmic, peripheral membrane protein associated with late endosomes/lysosomes. Colocalizes with M.tuberculosis PtpA in the cytosol of tuberculosis-infected macrophages and associates with phagosomes. Colocalizes in clusters with VIPAS39 at cytoplasmic organelles.
  • Database links

  • Alternative names

    • FLJ14848 antibody
    • hVPS 33B antibody
    • hVPS33B antibody
    • Vacuolar protein sorting 33 homolog B (yeast) antibody
    • Vacuolar protein sorting 33 homolog B antibody
    • Vacuolar protein sorting 33B (yeast) antibody
    • Vacuolar protein sorting 33B antibody
    • Vacuolar protein sorting associated protein 33B antibody
    • VPS 33B antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for VPS33B using ab234799 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-VPS33B antibody (ab234799) at 1/1000 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : A549 (human lung carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 71 kDa

  • Paraffin-embedded human brain tissue stained for VPS33B using ab234799 at 1/100 dilution in immunohistochemical analysis.

References

ab234799 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234799.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up