Overview

  • Product name

    Anti-VPS37A/HCRP1 antibody
    See all VPS37A/HCRP1 primary antibodies
  • Description

    Rabbit polyclonal to VPS37A/HCRP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human VPS37A/HCRP1 aa 1-397. Expressed in E.coli. N-terminal tags.
    Sequence:

    MSWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSIAEIQKDV EYRLPFTINNLTININILLPPQFPQEKPVISVYPPIRHHLMDKQGVYVTS PLVNNFTMHSDLGKIIQSLLDEFWKNPPVLAPTSTAFPYLYSNPSGMSPY ASQGFPFLPPYPPQEANRSITSLSVADTVSSSTTSHTTAKPAAPSFGVLS NLPLPIPTVDASIPTSQNGFGYKMPDVPDAFPELSELSVSQLTDMNEQEE VLLEQFLTLPQLKQIITDKDDLVKSIEELARKNLLLEPSLEAKRQTVLDK YELLTQMKSTFEKKMQRQHELSESCSASALQARLKVAAHEAEEESDNIAE DFLEGKMEIDDFLSSFMEKRTICHCRRAKEEKLQQAIAMHSQFHAPL


    Database link: Q8NEZ2

  • Positive control

    • WB: HeLa cell lysate; Recombinant human VPS37A/HCRP1 protein. IHC-P: Human breast cancer, pancreatic cancer, prostate, prostate cancer, liver and liver cancer tissue.
  • General notes

     This product was previously labelled as VPS37A

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233423 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml.

Target

  • Relevance

    VPS37A, vacuolar protein sorting 37A, is a component of the ESCRT-I complex, a regulator of vesicular trafficking process. It is required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies and may be involved in cell growth and differentiation.
  • Cellular localization

    Late endosome membrane; Peripheral membrane protein. Nucleus.
  • Database links

  • Alternative names

    • 2210018P21Rik antibody
    • 4930592A21Rik antibody
    • AW261445 antibody
    • D8Ertd531e antibody
    • ESCRT I complex subunit VPS37A antibody
    • FLJ32642 antibody
    • FLJ42616 antibody
    • HCRP1 antibody
    • hepatocellular carcinoma related protein 1 antibody
    • hVps37A antibody
    • MGC116266 antibody
    • polyglutamine binding protein 2 antibody
    • PQBP2 antibody
    • vacuolar protein sorting 37A antibody
    • Vacuolar protein sorting associated protein 37A antibody
    see all

Images

  • Anti-VPS37A/HCRP1 antibody (ab233423) at 1 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
  • Formalin-fixed, paraffin-embedded human liver tissue stained for VPS37A/HCRP1 using ab233423 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver cancer tissue stained for VPS37A/HCRP1 using ab233423 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate cancer tissue stained for VPS37A/HCRP1 using ab233423 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate tissue stained for VPS37A/HCRP1 using ab233423 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human pancreatic cancer tissue stained for VPS37A/HCRP1 using ab233423 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for VPS37A/HCRP1 using ab233423 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Anti-VPS37A/HCRP1 antibody (ab233423) at 2 µg/ml + Recombinant human VPS37A/HCRP1 protein

References

ab233423 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233423.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up