Overview

  • Product name

  • Description

    Rabbit polyclonal to VPS4a
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human VPS4a aa 1-120.
    Sequence:

    MTTSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSD KAKESIRAKCVQYLDRAEKLKDYLRSKEKHGKKPVKENQSEGKGSDSDSE GDNPEKKKLQEQLMGAVVME


    Database link: Q9UN37

  • Positive control

    • WB: Mouse kidney and brain lysates; Rat gonadal lysate; U-87 MG and MCF7 whole cell lysates. IHC-P: Human lung and testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab229806 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Detects a band of approximately 49 kDa (predicted molecular weight: 49 kDa).

Target

  • Function

    Involved in late steps of the endosomal multivesicular bodies (MVB) pathway. Recognizes membrane-associated ESCRT-III assemblies and catalyzes their disassembly, possibly in combination with membrane fission. Redistributes the ESCRT-III components to the cytoplasm for further rounds of MVB sorting. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. In conjunction with the ESCRT machinery also appears to function in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and enveloped virus budding (HIV-1 and other lentiviruses). Involved in cytokinesis.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Belongs to the AAA ATPase family.
    Contains 1 MIT domain.
  • Domain

    The MIT domain serves as an adapter for ESCRT-III proteins. It forms an asymmetric three-helix bundle that binds amphipathic MIM (MIT interacting motif) helices along the groove between MIT helices 2 and 3 present in a subset of ESCRT-III proteins thus establishing the canonical MIM-MIT interaction. In an extended conformation along the groove between helices 1 and 3, also binds to a type-2 MIT interacting motif (MIM2).
  • Cellular localization

    Prevacuolar compartment membrane. Late endosome membrane. Membrane-associated in the prevacuolar endosomal compartment. Localizes to the midbody of dividing cells. Localized in two distinct rings on either side of the Fleming body.
  • Information by UniProt
  • Database links

  • Alternative names

    • hVPS4 antibody
    • Protein SKD2 antibody
    • SKD1 antibody
    • SKD1 homolog antibody
    • SKD1A antibody
    • SKD2 antibody
    • Vacuolar protein sorting 4 homolog A antibody
    • Vacuolar protein sorting 4, yeast, homolog of, A antibody
    • Vacuolar protein sorting factor 4A antibody
    • Vacuolar protein sorting-associated protein 4A antibody
    • vacuolar sorting protein 4 antibody
    • VPS4 antibody
    • VPS4-1 antibody
    • Vps4a antibody
    • VPS4A_HUMAN antibody
    see all

Images

  • All lanes : Anti-VPS4a antibody (ab229806) at 1/1000 dilution

    Lane 1 : Mouse kidney lysate
    Lane 2 : Rat gonadal lysate
    Lane 3 : Mouse brain lysate
    Lane 4 : U-87 MG (human glioblastoma-astrocytoma epithelial cell line) whole cell lysate
    Lane 5 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 49 kDa

  • Paraffin-embedded human lung tissue stained for VPS4a with ab229806 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for VPS4a with ab229806 at 1/100 dilution in immunohistochemical analysis.

References

ab229806 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229806.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up