Overview

  • Product name

  • Description

    Rabbit polyclonal to VPS4B/MIG1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human VPS4B/MIG1 aa 1-117.
    Sequence:

    MSSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQ GDKAKQSIRAKCTEYLDRAEKLKEYLKNKEKKAQKPVKEGQPSPADEKGN DSDGEGESDDPEKKKLQ


    Database link: O75351

  • Positive control

    • WB: Mouse heart and brain tissue lysate. ICC/IF: MCF7 cells. IHC-P: Human small intestine tissue.
  • General notes

     This product was previously labelled as VPS4B

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224736 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
WB 1/200 - 1/5000.
IHC-P 1/20 - 1/200.

Target

  • Function

    Involved in late steps of the endosomal multivesicular bodies (MVB) pathway. Recognizes membrane-associated ESCRT-III assemblies and catalyzes their disassembly, possibly in combination with membrane fission. Redistributes the ESCRT-III components to the cytoplasm for further rounds of MVB sorting. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. In conjunction with the ESCRT machinery also appears to function in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and enveloped virus budding (HIV-1 and other lentiviruses).
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Belongs to the AAA ATPase family.
    Contains 1 MIT domain.
  • Domain

    The MIT domain serves as an adapter for ESCRT-III proteins. It forms an asymmetric three-helix bundle that binds amphipathic MIM (MIT interacting motif) helices along the groove between MIT helices 2 and 3 present in a subset of ESCRT-III proteins thus establishing the canonical MIM-MIT interaction. In an extended conformation along the groove between helices 1 and 3, also binds to a type-2 MIT interacting motif (MIM2).
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Prevacuolar compartment membrane. Late endosome membrane. Membrane-associated in the prevacuolar endosomal compartment. Localized in HIV-1 particles purified from acutely infected cells.
  • Information by UniProt
  • Database links

  • Alternative names

    • 8030489C12Rik antibody
    • Cell migration inducing 1 antibody
    • Cell migration-inducing gene 1 protein antibody
    • MGC116271 antibody
    • MIG1 antibody
    • Protein SKD1 antibody
    • Skd1 antibody
    • SKD1B antibody
    • Suppressor of K(+) transport growth defect 1 antibody
    • Suppressor of K+ transport defect 1 antibody
    • Vacuolar protein sorting 4 homolog B (S. cerevisiae) antibody
    • Vacuolar protein sorting 4 homolog B antibody
    • Vacuolar protein sorting 4b antibody
    • Vacuolar protein sorting-associated protein 4B antibody
    • Vacuolar protein sorting-associating protein 4B antibody
    • VPS4 2 antibody
    • VPS42 antibody
    • Vps4b antibody
    • VPS4B_HUMAN antibody
    see all

Images

  • All lanes : Anti-VPS4B/MIG1 antibody (ab224736) at 1/200 dilution

    All lanes : Mouse heart tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Developed using the ECL technique.
  • Paraffin embedded human small intestine tissue stained for VPS4B/MIG1 with ab224736 (1/100 dilution) in immunohistochemical analysis.

  • MCF7 (human breast adenocarcinoma cell line) cells stained for VPS4B/MIG1 (green) using ab224736 (1/100 dilution) in ICC/IF. Secondary: Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab224736 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224736.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up