Overview

  • Product name

  • Description

    Rabbit polyclonal to VRK1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human VRK1 aa 5-141.
    Sequence:

    KAAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLA DMNSSESVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRK LKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKI


    Database link: Q99986

  • Positive control

    • IHC: Human testis tissue; ICC/IF: U-251 MG cells. WB: Rh30 and HL-60 cell lysates

Properties

Applications

Our Abpromise guarantee covers the use of ab211358 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/250 - 1/500. Predicted molecular weight: 45 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Serine/threonine kinase that phosphorylates 'Thr-18' of p53/TP53 and may thereby prevent the interaction between p53/TP53 and MDM2.
  • Tissue specificity

    Widely expressed. Highly expressed in fetal liver, testis and thymus.
  • Involvement in disease

    Defects in VRK1 are the cause of pontocerebellar hypoplasia type 1 (PCH1) [MIM:607596]; also called pontocerebellar hypoplasia with infantile spinal muscular atrophy or pontocerebellar hypoplasia with anterior horn cell disease. PCH1 is characterized by an abnormally small cerebellum and brainstem, central and peripheral motor dysfunction from birth, gliosis and anterior horn cell degeneration resembling infantile spinal muscular atrophy (SMA).
  • Sequence similarities

    Belongs to the protein kinase superfamily. CK1 Ser/Thr protein kinase family. VRK subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Autophosphorylated at various serine and threonine residues. Autophosphorylation does not impair its ability to phosphorylate p53/TP53.
  • Cellular localization

    Nucleus. Dispersed throughout the cell but not located on mitotic spindle or chromatids during mitosis.
  • Information by UniProt
  • Database links

  • Alternative names

    • MGC117401 antibody
    • MGC138280 antibody
    • MGC142070 antibody
    • PCH1 antibody
    • PCH1A antibody
    • Serine/threonine protein kinase VRK1 antibody
    • Serine/threonine-protein kinase VRK1 antibody
    • Vaccinia related kinase 1 antibody
    • Vaccinia virus B1R related kinase 1 antibody
    • Vaccinia-related kinase 1 antibody
    • VRK1 antibody
    • VRK1_HUMAN antibody
    see all

Images

  • All lanes : Anti-VRK1 antibody (ab211358) at 0.4 µg/ml

    Lane 1 : Rh30 cell lysate with siRNA control
    Lane 2 : Rh30 cell lysate with siRNA Target specific probe

    Predicted band size: 45 kDa

  • Immunohistochemical analysis of paraffin-embedded Human testis tissue labeling VRK1 with ab211358 at 1/200 dilution.

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-251 MG cells labeling VRK1 with ab211358 at 4 µg/ml.

  • Anti-VRK1 antibody (ab211358) at 0.4 µg/ml + HL-60 (Human promyelocytic leukemia) cell lysate

    Predicted band size: 45 kDa

References

ab211358 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211358.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up