Overview

  • Product name

    Anti-VRK3 antibody
  • Description

    Rabbit polyclonal to VRK3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human VRK3 aa 19-91.
    Sequence:

    CPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKWSST VTSPRLSLFSDGDSSESEDTLSS


    Database link: Q8IV63

  • Positive control

    • IHC-P: Human duodenum tissue. ICC/IF: A549 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220830 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Inactive kinase that suppresses ERK activity by promoting phosphatase activity of DUSP3 which specifically dephosphorylates and inactivates ERK in the nucleus.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CK1 Ser/Thr protein kinase family. VRK subfamily.
    Contains 1 protein kinase domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Inactive serine/threonine-protein kinase VRK3 antibody
    • Serine/threonine protein kinase VRK3 antibody
    • Serine/threonine-protein pseudokinase VRK3 antibody
    • Vaccinia related kinase 3 antibody
    • Vaccinia-related kinase 3 antibody
    • Vrk3 antibody
    • VRK3_HUMAN antibody
    see all

Images

  • Immunofluorescent analysis of PFA fixed, triton X-100 permeabilized A549 cells labeling VRK3 with ab220830 at 4 µg/mL (green).

  • Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded human duodenum tissue sections labeling VRK3 with ab220830 at a 1/1000 dilution.

References

ab220830 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220830.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up