Overview

  • Product name

  • Description

    Rabbit polyclonal to VSIG4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human VSIG4 aa 171-271.
    Sequence:

    PPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSE QHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGY L


    Database link: Q9Y279

  • Positive control

    • WB: Jurkat whole cell lysate. IHC-P: Human placenta and lung tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab246869 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 44 kDa.

Target

  • Function

    Phagocytic receptor, strong negative regulator of T-cell proliferation and IL2 production. Potent inhibitor of the alternative complement pathway convertases.
  • Tissue specificity

    Abundantly expressed in several fetal tissues. In adult tissues, highest expression in lung and placenta. Expressed in resting macrophages.
  • Sequence similarities

    Contains 2 Ig-like (immunoglobulin-like) domains.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Complement receptor of the immunoglobulin superfamily antibody
    • CRIg antibody
    • Ig superfamily protein antibody
    • Protein Z39Ig antibody
    • UNQ317/PRO362 antibody
    • V set and immunoglobulin domain containing 4 antibody
    • V-set and immunoglobulin domain-containing protein 4 antibody
    • VSIG4 antibody
    • VSIG4_HUMAN antibody
    • Z39IG antibody
    see all

Images

  • Anti-VSIG4 antibody (ab246869) at 0.4 µg/ml + Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate

    Predicted band size: 44 kDa

  • Paraffin-embedded human lung tissue stained for VSIG4 using ab246869 at 1/200 dilution in immunohistochemical analysis.
  • Paraffin-embedded human placenta tissue stained for VSIG4 using ab246869 at 1/200 dilution in immunohistochemical analysis.
  • Paraffin-embedded human skeletal muscle tissue stained for VSIG4 using ab246869 at 1/200 dilution in immunohistochemical analysis.

References

ab246869 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246869.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up