
  • Product name

    Anti-VWC2L antibody
  • Description

    Rabbit polyclonal to VWC2L
  • Host species

  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    antigen sequence AAISHEDYPADEGDQISSNDNLIFDDYRGK, corresponding to amino acids 22-51 of Human VWC2L.

  • Positive control

    • Human bone marrow tissue.



Our Abpromise guarantee covers the use of ab126498 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.



  • ab126498, at 1/50, staining VWC2L in paraffin embedded Human bone marrow by Immunohistochemistry.


ab126498 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab126498.
Please use the links above to contact us or submit feedback about this product.

For licensing inquiries, please contact partnerships@abcam.com

Sign up