Overview

  • Product name

  • Description

    Mouse polyclonal to WAPL/FOE
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Full length protein corresponding to Human WAPL/FOE aa 1-402.
    Sequence:

    MDLDRASLDLMIRLLELEQDASSAKLLNEKDMNKIKEKIRRLCETVHNKH LDLENITTGHLAMETLLSLTSKRAGDWFKEELRLLGGLDHIVDKVKECVD HLSRDEDEEKLVASLWGAERCLRVLESVTVHNPENQSYLIAYKDSQLIVS SAKALQHCEELIQQYNRAEDSICLADSKPLPHQNVTNHVGKAVEDCMRAI IGVLLNLTNDNEWGSTKTGEQDGLIGTALNCVLQVPKYLPQEQRFDIRVL LFLERERAAQLAESKTDELIKDAPTTQHDKSGEWQETSGEIQWVSTEKTD GTEEKHKKEEEDEELDLNKALQHAGKHMEDCIVASYTALLLGCLCQESPI NVTTVREYLPEGDFSIMTEMLKKFLSFMNLTCAVGTTGQKSISRVIEYLE HC

  • Positive control

    • WB: 293T cells transfected with WAPL/FOE. IF: HeLa cells.
  • General notes

     This product was previously labelled as WAPL

     

Properties

Applications

Our Abpromise guarantee covers the use of ab168612 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 133 kDa.
ICC/IF Use a concentration of 10 µg/ml.

Target

  • Function

    Regulator of sister chromatid cohesion in mitosis which negatively regulates cohesin association with chromatin. Involved in both sister chromatid cohesion during interphase and sister-chromatid resolution during early stages of mitosis. Couples DNA replication to sister chromatid cohesion. Cohesion ensures that chromosome partitioning is accurate in both meiotic and mitotic cells and plays an important role in DNA repair.
  • Tissue specificity

    Isoform 1 is highly expressed in uterine cervix tumor. Isoform 2 is widely expressed with a high level in skeletal muscle and heart.
  • Sequence similarities

    Contains 1 WAPL domain.
  • Cellular localization

    Nucleus and Nucleus. Chromosome. Cytoplasm. Associates with chromatin through the cohesin complex during interphase. Released in the cytoplasm from nuclear envelope breakdown until anaphase, it reaccumulates in nucleus at telophase.
  • Information by UniProt
  • Database links

  • Alternative names

    • FOE antibody
    • Friend of EBNA2 (Epstein Barr virus nuclear protein 2) antibody
    • Friend of EBNA2 protein antibody
    • KIAA0261 antibody
    • OTTHUMP00000020004 antibody
    • WAPAL antibody
    • WAPL antibody
    • WAPL_HUMAN antibody
    • Wings apart like homolog antibody
    • Wings apart like homolog (Drosophila) antibody
    • Wings apart-like protein homolog antibody
    see all

Images

  • All lanes : Anti-WAPL/FOE antibody (ab168612) at 1 µg/ml

    Lane 1 : Lysate of 293T cells transfected with WAPL/FOE (44.22 KDa)
    Lane 2 : Lysate of untransfected 293T cells

    Lysates/proteins at 15 µl per lane.

    Predicted band size: 133 kDa

  • Immunofluorescence analysis of HeLa cells labeling WAPAL with ab168612 at 10 µg/ml.

References

ab168612 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab168612.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up