Overview

  • Product name

  • Description

    Rabbit polyclonal to Warp
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse Warp aa 135-366.
    Sequence:

    VPKVLVWVTDGGSSDPVGPPMQELKDLGVTIFIVSTGRGNLLELLAAASA PAEKHLHFVDVDDLPIIARELRGSITDAMQPQQLHASEVLSSGFRLSWPP LLTADSGYYVLELVPSGKLATTRRQQLPGNATSWTWTDLDPDTDYEVSLL PESNVHLLRPQHVRVRTLQEEAGPERIVISHARPRSLRVSWAPALGPDSA LGYHVQLGPLQGGSLERVEVPAGQNSTTVQGL


    Database link: Q8R2Z5

  • Positive control

    • WB: Recombinant mouse Warp protein; Mouse heart lysate. IHC-P: Mouse testis tissue.
  • General notes

     This product was previously labelled as VWA1

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab230991 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230991 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 45 kDa.

Target

Images

  • Anti-Warp antibody (ab230991) at 2 µg/ml + Recombinant mouse Warp protein

    Predicted band size: 45 kDa

  • Anti-Warp antibody (ab230991) at 2 µg/ml + Mouse heart lysate

    Predicted band size: 45 kDa

  • Formalin-fixed, paraffin-embedded mouse testis tissue stained for Warp using ab230991 at 20 μg/ml in immunohistochemical analysis.

References

ab230991 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230991.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up