Overview

  • Product name

  • Description

    Rabbit polyclonal to Warp
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human Warp aa 43-285. Expressed in E. coli.
    Sequence:

    MGSSHHHHHH SSGLVPRGSH MASMTGGQQMGRGSEF-ASVSHYEFSRVREFVGQLVATMPFGPGALRASL VHVGSRPHTEFTFDQYSSGQAIQDAVRVAPQRMGDTNTGLALAYAKEQLF AEEAGARLGVPKVLVWVTDGASSDSVGPPMQELKDLGVTIFIVSTGRGNL LELLAAASAPAEKHLHFVDVDDLPIIARELRGAIIDAMQPHQLHASEILS NGFRLSWPPLLTADSGYYVLELVPSGKLAATRRQQLPGNATSWTWTDLNP DTDYEVSLLP


    Database link: Q6PCB0

  • Positive control

    • IHC-P: Rat kidney tissue. WB: HepG2 cell lysate; Human lung and rat kidney lysate. Recombinant rat Warp protein.
  • General notes

     This product was previously labelled as VWA1

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231001 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml.

Target

Images

  • Formalin-fixed, paraffin-embedded rat kidney tssue stained for Warp using ab231001 at 20 µg/ml in immunhistochemical analysis.

  • Anti-Warp antibody (ab231001) at 1 µg/ml + Rat kidney lysate

    Developed using the ECL technique.
  • Anti-Warp antibody (ab231001) at 1 µg/ml + Human lung lysate
  • Anti-Warp antibody (ab231001) at 1 µg/ml + HepG2 (human liver hepatocellular carcinoma cell line) cell lysate

    Developed using the ECL technique.
  • Anti-Warp antibody (ab231001) at 1 µg/ml + Recombinant rat Warp protein

    Developed using the ECL technique.

References

ab231001 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231001.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up