Anti-WASP/Wiskott-Aldrich syndrome protein antibody [7B10E4] (ab202025)

Overview

  • Product name

    Anti-WASP/Wiskott-Aldrich syndrome protein antibody [7B10E4]
    See all WASP/Wiskott-Aldrich syndrome protein primary antibodies
  • Description

    Mouse monoclonal [7B10E4] to WASP/Wiskott-Aldrich syndrome protein
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human WASP/Wiskott-Aldrich syndrome protein aa 57-170. Expressed in E. Coli.
    Sequence:

    LPPGAEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLV YSTPTPFFHTFAGDDCQAGLNFADEDEAQAFRALVQEKIQKRNQRQSGDR RQLPPPPTPANEER


    Database link: P42768

  • Positive control

    • Human WASP/Wiskott-Aldrich syndrome protein (aa: 57-170) recombinant protein; Human WASP/Wiskott-Aldrich syndrome protein (aa: 57-170)-hIgGFc transfected HEK293 cell lysate; HeLa cells; Human ovarian cancer and colon cancer tissues
  • General notes

     This product was previously labelled as WASP

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    7B10E4
  • Isotype

    IgG2a
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab202025 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 53 kDa.
IHC-P 1/200 - 1/1000.
Flow Cyt 1/200 - 1/400.

ab170191 - Mouse monoclonal IgG2a, is suitable for use as an isotype control with this antibody.

 

Target

  • Function

    Effector protein for Rho-type GTPases, providing a link with the Arp2/3 complex that regulates the structure and dynamics of the actin cytoskeleton. Important for efficient actin polymerization. Possible regulator of lymphocyte and platelet function.
  • Tissue specificity

    Expressed predominantly in the thymus. Also found, to a much lesser extent, in the spleen.
  • Involvement in disease

    Defects in WAS are the cause of Wiskott-Aldrich syndrome (WAS) [MIM:301000]; also known as eczema-thrombocytopenia-immunodeficiency syndrome. WAS is an X-linked recessive immunodeficiency characterized by eczema, thrombocytopenia, recurrent infections, and bloody diarrhea. Death usually occurs before age 10.
    Defects in WAS are the cause of thrombocytopenia type 1 (THC1) [MIM:313900]. Thrombocytopenia is defined by a decrease in the number of platelets in circulating blood, resulting in the potential for increased bleeding and decreased ability for clotting.
    Defects in WAS are a cause of neutropenia severe congenital X-linked (XLN) [MIM:300299]. XLN is an immunodeficiency syndrome characterized by recurrent major bacterial infections, severe congenital neutropenia, and monocytopenia.
  • Sequence similarities

    Contains 1 CRIB domain.
    Contains 1 WH1 domain.
    Contains 1 WH2 domain.
  • Domain

    The WH1 (Wasp homology 1) domain may bind a Pro-rich ligand.
    The CRIB (Cdc42/Rac-interactive-binding) region binds to the C-terminal WH2 domain in the autoinhibited state of the protein. Binding of Rho-type GTPases to the CRIB induces a conformation change and leads to activation.
  • Cellular localization

    Cytoplasm > cytoskeleton.
  • Information by UniProt
  • Database links

  • Alternative names

    • Eczema thrombocytopenia antibody
    • IMD2 antibody
    • SCNX antibody
    • THC antibody
    • THC1 antibody
    • Thrombocytopenia 1 (X linked) antibody
    • U42471 antibody
    • Was antibody
    • WASp antibody
    • WASP_HUMAN antibody
    • Wiskott Aldrich syndrome (eczema thrombocytopenia) antibody
    • Wiskott Aldrich syndrome antibody
    • Wiskott Aldrich syndrome protein antibody
    • Wiskott-Aldrich syndrome protein antibody
    see all

Images

  • Anti-WASP/Wiskott-Aldrich syndrome protein antibody [7B10E4] (ab202025) at 1/500 dilution + Human WASP/Wiskott-Aldrich syndrome protein (aa: 57-170) recombinant protein at 1 µg

    Predicted band size: 53 kDa



    Expected MW is 39 kDa

  • All lanes : Anti-WASP/Wiskott-Aldrich syndrome protein antibody [7B10E4] (ab202025) at 1/500 dilution

    Lane 1 : Non transfected HEK293 cell lysate
    Lane 2 : Human WASP/Wiskott-Aldrich syndrome protein (aa: 57-170)-hIgGFc transfected HEK293 cell lysate

    Lysates/proteins at 1 µg per lane.

    Predicted band size: 53 kDa

  • Flow cytometric analysis of HeLa cells labeling WASP/Wiskott-Aldrich syndrome protein using ab202025 at 1/200 dilution (green) and negative control (red).

  • Immunohistochemical analysis of paraffin embedded Human ovarian cancer tissues labeling WASP/Wiskott-Aldrich syndrome protein using ab202025 at 1/200 dilution, followed by DAB staining.

  • Immunohistochemical analysis of paraffin embedded Human colon cancer tissues labeling WASP/Wiskott-Aldrich syndrome protein using ab202025 at 1/200 dilution, followed by DAB staining.

References

ab202025 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202025.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up