Overview

  • Product name

    Anti-WASP/Wiskott-Aldrich syndrome protein antibody
    See all WASP/Wiskott-Aldrich syndrome protein primary antibodies
  • Description

    Rabbit polyclonal to WASP/Wiskott-Aldrich syndrome protein
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human WASP/Wiskott-Aldrich syndrome protein aa 39-251. Expressed in E.coli. N-terminal tags.
    Sequence:

    LGRKCLTLATAVVQLYLALPPGAEHWTKEHCGAVCFVKDNPQKSYFIRLY GLQAGRLLWEQELYSQLVYSTPTPFFHTFAGDDCQAGLNFADEDEAQAFR ALVQEKIQKRNQRQSGDRRQLPPPPTPANEERRGGLPPLPLHPGGDQGGP PVGPLSLGLATVDIQNPDITSSRYRGLPAPGPSPADKKRSGKKKISKADI GAPSGFKHVSHVG


    Database link: P42768

  • Positive control

    • WB: HL-60 cell lysate; Recombinant human WASP/Wiskott-Aldrich syndrome protein. IHC-P: Human spleen tissue.
  • General notes

     This product was previously labelled as WASP

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatograph.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233216 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml.

Target

  • Function

    Effector protein for Rho-type GTPases, providing a link with the Arp2/3 complex that regulates the structure and dynamics of the actin cytoskeleton. Important for efficient actin polymerization. Possible regulator of lymphocyte and platelet function.
  • Tissue specificity

    Expressed predominantly in the thymus. Also found, to a much lesser extent, in the spleen.
  • Involvement in disease

    Defects in WAS are the cause of Wiskott-Aldrich syndrome (WAS) [MIM:301000]; also known as eczema-thrombocytopenia-immunodeficiency syndrome. WAS is an X-linked recessive immunodeficiency characterized by eczema, thrombocytopenia, recurrent infections, and bloody diarrhea. Death usually occurs before age 10.
    Defects in WAS are the cause of thrombocytopenia type 1 (THC1) [MIM:313900]. Thrombocytopenia is defined by a decrease in the number of platelets in circulating blood, resulting in the potential for increased bleeding and decreased ability for clotting.
    Defects in WAS are a cause of neutropenia severe congenital X-linked (XLN) [MIM:300299]. XLN is an immunodeficiency syndrome characterized by recurrent major bacterial infections, severe congenital neutropenia, and monocytopenia.
  • Sequence similarities

    Contains 1 CRIB domain.
    Contains 1 WH1 domain.
    Contains 1 WH2 domain.
  • Domain

    The WH1 (Wasp homology 1) domain may bind a Pro-rich ligand.
    The CRIB (Cdc42/Rac-interactive-binding) region binds to the C-terminal WH2 domain in the autoinhibited state of the protein. Binding of Rho-type GTPases to the CRIB induces a conformation change and leads to activation.
  • Cellular localization

    Cytoplasm > cytoskeleton.
  • Information by UniProt
  • Database links

  • Alternative names

    • Eczema thrombocytopenia antibody
    • IMD2 antibody
    • SCNX antibody
    • THC antibody
    • THC1 antibody
    • Thrombocytopenia 1 (X linked) antibody
    • U42471 antibody
    • Was antibody
    • WASp antibody
    • WASP_HUMAN antibody
    • Wiskott Aldrich syndrome (eczema thrombocytopenia) antibody
    • Wiskott Aldrich syndrome antibody
    • Wiskott Aldrich syndrome protein antibody
    • Wiskott-Aldrich syndrome protein antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human spleen tissue stained for WASP/Wiskott-Aldrich syndrome protein using ab233216 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Anti-WASP/Wiskott-Aldrich syndrome protein antibody (ab233216) at 1 µg/ml + HL-60 (human promyelocytic leukemia cell line) cell lysate

    Secondary
    HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 0.2 µg/ml
  • Anti-WASP/Wiskott-Aldrich syndrome protein antibody (ab233216) at 2 µg/ml + Recombinant human WASP/Wiskott-Aldrich syndrome protein

References

ab233216 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233216.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up