Overview

  • Product name

  • Description

    Rabbit polyclonal to WBSCR16
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human WBSCR16 aa 119-213.
    Sequence:

    TLLSSKTADVTKVWGMGLNKDSQLGFHRSRKDKTRGYEYVLEPSPVSLPL DRPQETRVLQVSCGRAHSLVLTDREGVFSMGNNSYGQCGRKVVEN


    Database link: Q96I51

  • Positive control

    • A431 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab220397 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Use PFA/Triton X-100 Fixation/Permeabilization.

Target

  • Tissue specificity

    Ubiquitous.
  • Involvement in disease

    Note=WBSCR16 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region. Haploinsufficiency of WBSCR16 may be the cause of certain cardiovascular and musculo-skeletal abnormalities observed in the disease.
  • Sequence similarities

    Contains 6 RCC1 repeats.
  • Information by UniProt
  • Database links

  • Alternative names

    • 5730496C04Rik antibody
    • AU019812 antibody
    • DKFZp434D0421 antibody
    • MGC189739 antibody
    • MGC44931 antibody
    • RCC1-like G exchanging factor-like protein antibody
    • WBS16_HUMAN antibody
    • Wbscr16 antibody
    • Williams-Beuren syndrome chromosomal region 16 protein antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized A431 cells labeling WBSCR16 with ab220397 at 4 µg/ml (green).

References

ab220397 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220397.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up