Overview

  • Product name

  • Description

    Rabbit polyclonal to WDR11
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human WDR11 aa 268-348.
    Sequence:

    ILILDLEVNQTVGVIAIERTGVPFLQVIPCFQRDGLFCLHENGCITLRVR RSYNNIFTTSNEEPDPDPVQELTYDLRSQCD


    Database link: Q9BZH6

  • Positive control

    • IHC-P: Human gallbladder tissue. ICC/IF: A431 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab243476 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    WDR11 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. The WDR11 gene is located in the chromosome 10q25-26 region, which is frequently deleted in gliomas and tumors of other tissues, and is disrupted by the t(10;19) translocation rearrangement in glioblastoma cells. The gene location suggests that it is a candidate gene for the tumor suppressor locus.
  • Cellular localization

    Membrane; Single-pass membrane protein, Cytoplasmic and Nuclear
  • Database links

  • Alternative names

    • Bromodomain and WD repeat containing protein 2 antibody
    • Bromodomain and WD repeat domain containing 2 antibody
    • Bromodomain- and WD repeat-containing protein 2, formerly antibody
    • BRWD2 antibody
    • BRWD2, formerly antibody
    • DKFZp434L1715 antibody
    • DR11 antibody
    • FLJ42531 antibody
    • HH14 antibody
    • KIAA1351 antibody
    • WD repeat containing protein 11 antibody
    • WD repeat containing protein 15 antibody
    • WD repeat domain 11 antibody
    • WD repeat domain 15 antibody
    • WDR 11 antibody
    • WDR15 antibody
    see all

Images

  • PFA fixed, Triton X-100 permeabilized A431 (Human epidermoid carcinoma cell line) cells labeling WDR11 using ab243476 at 4 µg/ml (green) in ICC/IF. Nuclear probe is visualized in blue, microtubules in red.

  • Formalin-fixed, paraffin-embedded human gall bladder tissue stained for WDR11 with ab243476 at 1/50 dilution in immunohistochemical analysis.

References

ab243476 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243476.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up