Overview

  • Product name

  • Description

    Rabbit polyclonal to WDR19
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human WDR19 aa 45-226.
    Sequence:

    GQKRSEINLPGNCVAMDWDKDGDVLAVIAEKSSCIYLWDANTNKTSQLDN GMRDQMSFLLWSKVGSFLAVGTVKGNLLIYNHQTSRKIPVLGKHTKRITC GCWNAENLLALGGEDKMITVSNQEGDTIRQTQVRSEPSNMQFFLMKMDDR TSAAESMISVVLGKKTLFFLNLNEPDNPADLE


    Database link: Q8NEZ3

  • Positive control

    • IHC-P: Human liver cancer and placenta tissues. ICC/IF: A549 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab222908 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Function

    Component of the IFT complex A (IFT-A), a complex required for retrograde ciliary transport (PubMed:20889716). Involved in cilia function and/or assembly (By similarity). Associates with the BBSome complex to mediate ciliary transport.
  • Tissue specificity

    Some isoforms are tissue-specific. Highly expressed in the prostate. Lower expression in the cerebellum, pituitary gland, fetal lung, and pancreas. In normal prostate, expressed in both basal and luminal epithelial cells. No expression detected in fibromuscular stromal cells, endothelial cells, or infiltrating lymphocytes. Uniformed expression in prostate adenocarcinoma cells.
  • Involvement in disease

    Cranioectodermal dysplasia 4
    Short-rib thoracic dysplasia 5 with or without polydactyly
    Nephronophthisis 13
    Senior-Loken syndrome 8
  • Sequence similarities

    Contains 6 TPR repeats.
    Contains 6 WD repeats.
  • Developmental stage

    Expressed in fetal lung.
  • Cellular localization

    Cell projection, cilium. Cytoplasm, cytoskeleton, cilium basal body. Cell projection, cilium, photoreceptor outer segment. Localizes to photoreceptor connecting cilia, to the base of motile cilia in brain ependymal cells and to the base of and along primary cilia in kidney cells.
  • Information by UniProt
  • Database links

  • Alternative names

    • DYF 2 antibody
    • DYF2 antibody
    • FLJ23127 antibody
    • IFT144 antibody
    • Intraflagellar transport 144 homolog antibody
    • KIAA1638 antibody
    • ORF26 antibody
    • Oseg6 antibody
    • PWDMP antibody
    • WD repeat containing protein 19 antibody
    • WD repeat domain 19 antibody
    • WD repeat membrane protein PWDMP antibody
    • WD repeat-containing protein 19 antibody
    • Wdr19 antibody
    • WDR19_HUMAN antibody
    see all

Images

  • A549 (human lung carcinoma cell line) cells stained for WDR19 (green) using ab222908 at 1/100 dilution in ICC/IF. Secondary: Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human liver cancer tissue stained for WDR19 using ab222908 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human placenta tissue stained for WDR19 using ab222908 at 1/100 dilution in immunohistochemical analysis.

References

ab222908 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222908.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up