Overview

  • Product name

  • Description

    Rabbit polyclonal to WDR26
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, IHC-Frmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human WDR26 aa 260-310 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    SHAEDLRAKAEWEGKGTASRSKLLDKLQTYLPPSVMLPPRRLQTLLRQAV E


    Database link: Q9H7D7

  • Positive control

    • Rat heart tissue. Human laryngocarcinoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab203345 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

When using a fluorescent probe please use a dilution of 1/50 - 1/200.

WB 1/100 - 1/1000. Predicted molecular weight: 72 kDa.
IHC-Fr 1/100 - 1/500.

When using a fluorescent probe please use a dilution of 1/50 - 1/200.

Target

  • Relevance

    The WDR26 gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids, which are typically bracketed by gly-his and trp-asp (GH-WD). WD repeats may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Two transcript variants encoding two different isoforms have been found for this gene.
  • Cellular localization

    Cytoplasmic
  • Database links

  • Alternative names

    • CDW2 antibody
    • CUL4 and DDB1 associated WDR protein 2 antibody
    • GID complex subunit 7 homolog antibody
    • GID7 antibody
    • MIP2 antibody
    • Myocardial ischemic preconditioning up regulated protein 2 antibody
    • myocardial ischemic preconditioning upregulated protein 2 antibody
    • WD repeat domain 26 antibody
    see all

Images

  • Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded human laryngocarcinoma section labeling WDR26 with ab203345 at at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded rat heart section labeling WDR26 with ab203345 at at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab203345 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203345.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up