Overview

  • Product name

  • Description

    Rabbit polyclonal to WDR34
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human WDR34 aa 425-509.
    Sequence:

    APPLTSLQLSLKYLFAVRWSPVRPLVFAAASGKGDVQLFDLQKSSQKPTV LIKQTQDESPVYCLEFNSQQTQLLAAGDAQGTVKV


    Database link: Q96EX3

  • Positive control

    • IHC-P: Human stomach tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab243434 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. Inhibits the MAP3K7-induced NF-kappa-B activation pathway. Inhibits MAP3K7 phosphorylation at 'Thr-184' and 'Thr-187' upon Il-1 beta stimulation.
  • Tissue specificity

    Expressed in several cell lines (at protein level).
  • Sequence similarities

    Contains 5 WD repeats.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • bA216B9.3 antibody
    • DIC5 antibody
    • MGC20486 antibody
    • OTTHUMP00000022282 antibody
    • RP11 216B9.5 antibody
    • WD repeat containing protein 34 antibody
    • WD repeat domain 34 antibody
    • WD repeat-containing protein 34 antibody
    • WDR 34 antibody
    • Wdr34 antibody
    • WDR34_HUMAN antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for WDR34 with ab243434 at 1/50 dilution in immunohistochemical analysis.

References

ab243434 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243434.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up