Overview

  • Product name

    Anti-WDR37 antibody
  • Description

    Rabbit polyclonal to WDR37
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Xenopus laevis, Orangutan, Xenopus tropicalis
  • Immunogen

    Recombinant full length protein corresponding to Human WDR37 aa 1-496.
    Sequence:

    MPTESGSCSTARQAKQKRKSHSLSIRRTNSSEQERTGLPREMLEGQDSKL PSSVRSTLLELFGQIEREFENLYIENLELRREIDTLNERLAGEGQAIDGA ELSKGQLKTKASHSTSQLSQKLKTTYKASTSKIVSSFKTTTSRAICQLVK EYIGHRDGIWDVSVTRTQPIVLGTASADHTALLWSIETGKCLVKYAGHVG SVNSIKFHPSEQLALTASGDQTAHIWRYVVQLPTPQPVADTSQQISGEDE IECSDKDEPDIDGDVSSDCPTVRVPLTSLKSHQGVVIAADWLVGGKQVVT ASWDRTANLYDVETSELVHSLTGHDQELTHCCTHPTQRLVVTSSRDTTFR LWDFRDPSIHSVNVFQGHTDTVTSAVFTVGDNVVSGSDDRTVKVWDLKNM RSPIATIRTDSAINRINVCVGQKIIALPHDNRQVRLFDMSGVRLARLPRS SRQGHRRMVCCSAWSEDHPICNLFTCGFDRQAIGWNINIPALLQEK


    Database link: Q8CBE3

  • Positive control

    • WB: HepG2 cell lysate. IHC-P: Human colon cancer and appendix tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235046 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000.
IHC-P 1/200 - 1/500.

Target

Images

  • Anti-WDR37 antibody (ab235046) at 1/500 dilution + HepG2 (human liver hepatocellular carcinoma cell line) cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution
  • Paraffin-embedded human colon cancer tissue stained for WDR37 using ab235046 at 1/500 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at room temperature. Primary antibody (1% BSA) was incubated at 4°C overnight. The primary antibody was detected by a biotinylated secondary antibody and visualized using a HRP conjugated SP system.

  • Paraffin-embedded human appendix tissue stained for WDR37 using ab235046 at 1/500 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at room temperature. Primary antibody (1% BSA) was incubated at 4°C overnight. The primary antibody was detected by a biotinylated secondary antibody and visualized using a HRP conjugated SP system.

References

ab235046 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235046.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up