Anti-WDR42A antibody (ab176809)
Key features and details
- Rabbit polyclonal to WDR42A
- Suitable for: IP, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-WDR42A antibody -
Description
Rabbit polyclonal to WDR42A -
Host species
Rabbit -
Tested applications
Suitable for: IP, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Rabbit, Cow, Pig, Chimpanzee, Rhesus monkey, Gorilla, Chinese hamster, Orangutan -
Immunogen
Synthetic peptide within Human WDR42A aa 50-100. The exact sequence is proprietary. (NP_056541.2).
Sequence:LTGDDGGPNRTSTESRGTDTESSGEDKDSDSMEDTGHYSINDENRVHDRS E
Database link: Q5TAQ9 -
Positive control
- HeLa and 293T whole cell lysates.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6.8
Preservative: 0.09% Sodium azide
Constituents: 99% Tris buffered saline, 0.1% BSA -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab176809 was affinity purified using an epitope specific to WDR42A immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab176809 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IP |
Use at 2-5 µg/mg of lysate.
|
|
WB |
1/2000 - 1/10000. Predicted molecular weight: 67 kDa.
|
Notes |
---|
IP
Use at 2-5 µg/mg of lysate. |
WB
1/2000 - 1/10000. Predicted molecular weight: 67 kDa. |
Target
-
Relevance
This gene encodes a WD repeat-containing protein that interacts with the Cul4-Ddb1 E3 ligase macromolecular complex. May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex. The protein contains 7 WD repeats. There are two isoforms produced by alternative splicing. -
Database links
- Entrez Gene: 457434 Chimpanzee
- Entrez Gene: 510316 Cow
- Entrez Gene: 101144021 Gorilla
- Entrez Gene: 50717 Human
- Entrez Gene: 98193 Mouse
- Entrez Gene: 100174058 Orangutan
- Entrez Gene: 100153655 Pig
- Entrez Gene: 364050 Rat
see all -
Alternative names
- DCAF8 antibody
- DDB1 and CUL4 associated factor 8 antibody
- DKFZp781G1096 antibody
see all
Images
-
All lanes : Anti-WDR42A antibody (ab176809) at 0.04 µg/ml
Lane 1 : HeLa whole cell lysate at 50 µg
Lane 2 : HeLa whole cell lysate at 15 µg
Lane 3 : HeLa whole cell lysate at 5 µg
Lane 4 : 293T whole cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 67 kDa
Exposure time: 3 seconds -
Detection of WDR42A in immunoprecipitates of HeLa whole cell lysate (1 mg for IP, 20% of IP loaded) using ab176809 at 3 µg/mg lysate for IP (Lane 1) and at 0.4 µg/ml for subsequent Western blot detection. Lane 2 represents control IgG IP.
Detection: Chemiluminescence with an exposure time of 10 seconds.
Protocols
Datasheets and documents
-
Datasheet download
References (0)
ab176809 has not yet been referenced specifically in any publications.