Overview

  • Product name

  • Description

    Rabbit polyclonal to WDR42A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human WDR42A aa 1-135.
    Sequence:

    MSSKGSSTDGRTDLANGSLSSSPEEMSGAEEGRETSSGIEVEASDLSLSL TGDDGGPNRTSTESRGTDTESSGEDKDSDSMEDTGHYSINDENRVHDRSE EEEEEEEEEEEEQPRRRVQRKRANRDQDSSDDERA


    Database link: Q5TAQ9

  • Positive control

    • WB: Mouse heart and lung tissue lysates. IHC-P: Human prostate and endometrial cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab222831 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/5000. Detects a band of approximately 67 kDa (predicted molecular weight: 31,67 kDa).
IHC-P 1/20 - 1/200.

Target

  • Relevance

    This gene encodes a WD repeat-containing protein that interacts with the Cul4-Ddb1 E3 ligase macromolecular complex. May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex. The protein contains 7 WD repeats. There are two isoforms produced by alternative splicing.
  • Database links

  • Alternative names

    • DCAF8 antibody
    • DDB1 and CUL4 associated factor 8 antibody
    • DKFZp781G1096 antibody
    • FLJ35857 antibody
    • H326 antibody
    • MGC117276 antibody
    • MGC118891 antibody
    • MGC99640 antibody
    • WD repeat containing protein 42A antibody
    • WD repeat domain 42A antibody
    • WDR 42A antibody
    see all

Images

  • All lanes : Anti-WDR42A antibody (ab222831) at 1/2000 dilution

    Lane 1 : Mouse heart tissue lysate
    Lane 2 : Mouse liver tissue lysate

    Secondary
    All lanes : Goat Anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 31,67 kDa
    Observed band size: 67 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human prostate cancer tisssue stained for WDR42A using ab222831 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human endometrial cancer tisssue stained for WDR42A using ab222831 at 1/100 dilution in immunohistochemical analysis.

References

ab222831 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222831.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up