Overview

  • Product name

  • Description

    Rabbit polyclonal to WDR48/UAF1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human WDR48/UAF1 aa 362-450 (internal sequence).
    Sequence:

    SIIQCHILNDKRHILTKDTNNNVAYWDVLKACKVEDLGKVDFEDEIKKRF KMVYVPNWFSVDLKTGMLTITLDESDCFAAWVSAKDAGF

  • Positive control

    • Human colon tissue; RT 4, U51 MG, Human liver and Human tonsil lysates; A431 cells.
  • General notes

     This product was previously labelled as WDR48

     

Properties

Applications

Our Abpromise guarantee covers the use of ab122473 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 0.4 µg/ml.
ICC/IF Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Regulator of deubiquitinating complexes. Acts as a strong activator of USP1 by enhancing the USP1-mediated deubiquitination of FANCD2; USP1 being almost inactive by itself. Also activates deubiquitinating activity of complexes containing USP12 and USP46, respectively. Activates deubiquitination by increasing the catalytic turnover without increasing the affinity of deubiquitinating enzymes for the substrate. In case of infection by Herpesvirus saimiri, may play a role in vesicular transport or membrane fusion events necessary for transport to lysosomes. Induces lysosomal vesicle formation via interaction with Herpesvirus saimiri tyrosine kinase-interacting protein (TIP). Subsequently, TIP recruits tyrosine-protein kinase LCK, resulting in down-regulation of T-cell antigen receptor TCR. May play a role in generation of enlarged endosomal vesicles via interaction with TIP. In case of infection by papillomavirus HPV11, promotes the maintenance of the viral genome via its interaction with HPV11 helicase E1.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the WD repeat WDR48 family.
    Contains 8 WD repeats.
  • Domain

    N-terminal WD region interacts with TIP and C-terminal region mediates lysosomal localization. The WD repeats are required for the interaction with deubiquitinating enzymes USP1, USP12 and USP46.
  • Cellular localization

    Nucleus. Cytoplasm. Lysosome. Mainly cytoplasmic. In case of infection by papillomavirus HPV11, translocates to the nucleus via its interaction with papillomavirus HPV11.
  • Information by UniProt
  • Database links

  • Alternative names

    • p80 antibody
    • UAF 1 antibody
    • UAF1 antibody
    • USP1 associated factor 1 antibody
    • USP1-associated factor 1 antibody
    • WD repeat containing protein 48 antibody
    • WD repeat domain 48 antibody
    • WD repeat endosomal protein antibody
    • WD repeat-containing protein 48 antibody
    • WDR 48 antibody
    • WDR48 antibody
    • WDR48_HUMAN antibody
    see all

Images

  • All lanes : Anti-WDR48/UAF1 antibody (ab122473) at 1/100 dilution

    Lane 1 : NIH-3T3 cell lysate (Mouse embryonic cells)
    Lane 2 : NBT-II cell lysate (Rat Wistar bladder tumour cells)
  • ab122473, at 1/20 dilution, staining WDR48/UAF1 in paraffin-embedded Human colon tissue by Immunohistochemistry.

  • All lanes : Anti-WDR48/UAF1 antibody (ab122473) at 1/250 dilution

    Lane 1 : RT 4 cell lysate
    Lane 2 : U 251 MG cell lysate
    Lane 3 : Human plasma lysate
    Lane 4 : Human liver tissue lysate
    Lane 5 : Human tonsil tissue lysate

    Developed using the ECL technique.
  • ab122473, at 4 µg/ml, staining WDR48/UAF1 in PFA/Triton X-100 fixed/permeabilized A431 cells by Immunofluorescence (green).

References

This product has been referenced in:

  • Yu Z  et al. USP1-UAF1 deubiquitinase complex stabilizes TBK1 and enhances antiviral responses. J Exp Med 214:3553-3563 (2017). Read more (PubMed: 29138248) »
  • Gabriel CH  et al. Identification of Novel Nuclear Factor of Activated T Cell (NFAT)-associated Proteins in T Cells. J Biol Chem 291:24172-24187 (2016). Read more (PubMed: 27637333) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab122473.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up