Anti-WDR5 antibody (ab176588)
Key features and details
- Rabbit polyclonal to WDR5
- Suitable for: IHC-P
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-WDR5 antibody
See all WDR5 primary antibodies -
Description
Rabbit polyclonal to WDR5 -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species IHC-P MouseHuman
-
Immunogen
Synthetic peptide within Human WDR5 aa 50-100. The exact sequence is proprietary. (NP_060058.1).
Sequence:SVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDS N
Database link: P61964
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6.8
Preservative: 0.09% Sodium azide
Constituents: 99% Tris buffered saline, 0.1% BSA -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
ab176588 was affinity purified using an epitope specific to WDR5 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab176588 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Tested applications are guaranteed to work and covered by our Abpromise guarantee.
Predicted to work for this combination of applications and species but not guaranteed.
Does not work for this combination of applications and species.
| Application | Species |
|---|---|
| IHC-P |
Mouse
Human
|
| All applications |
Horse
Chicken
Cow
Dog
Pig
Xenopus laevis
Drosophila melanogaster
Zebrafish
Orangutan
Xenopus tropicalis
|
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P |
1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
| Notes |
|---|
|
IHC-P
1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Contributes to histone modification. May position the N-terminus of histone H3 for efficient trimethylation at 'Lys-4'. As part of the MLL1/MLL complex it is involved in methylation and dimethylation at 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. As part of the NSL complex it may be involved in acetylation of nucleosomal histone H4 on several lysine residues. May regulate osteoblasts differentiation. -
Sequence similarities
Belongs to the WD repeat WDR5/wds family.
Contains 7 WD repeats. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 417144 Chicken
- Entrez Gene: 100125836 Cow
- Entrez Gene: 11091 Human
- Entrez Gene: 140858 Mouse
- Entrez Gene: 100156729 Pig
- Entrez Gene: 496891 Xenopus tropicalis
- Omim: 609012 Human
- SwissProt: Q2KIG2 Cow
see all -
Alternative names
- 2410008O07Rik antibody
- AA408785 antibody
- AA960360 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-WDR5 antibody (ab176588)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse renal cell carcinoma tissue labeling WDR5 with ab176588 at 1/250 dilution. Detection: DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-WDR5 antibody (ab176588)Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human ovarian carcinoma tissue labeling WDR5 with ab176588 at 1/250 dilution. Detection: DAB staining.
Datasheets and documents
References (1)
ab176588 has been referenced in 1 publication.
- Chen X et al. Upregulated WDR5 promotes proliferation, self-renewal and chemoresistance in bladder cancer via mediating H3K4 trimethylation. Sci Rep 5:8293 (2015). IHC . PubMed: 25656485
