Anti-WDR5 antibody (ab176588)
- Datasheet
- References (1)
- Protocols
Overview
-
Product name
Anti-WDR5 antibody
See all WDR5 primary antibodies -
Description
Rabbit polyclonal to WDR5 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Horse, Chicken, Cow, Dog, Pig, Xenopus laevis, Drosophila melanogaster, Zebrafish, Orangutan, Xenopus tropicalis
-
Immunogen
Synthetic peptide within Human WDR5 aa 50-100. The exact sequence is proprietary. (NP_060058.1).
Sequence:SVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDS N
Database link: P61964 -
Positive control
- Human Breast Carcinoma and Ovarian Carcinoma tissues; mouse renal cell carcinoma tissue.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 99% Tris buffered saline, 0.1% BSA -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
ab176588 was affinity purified using an epitope specific to WDR5 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab176588 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
| ICC/IF | 1/50 - 1/500. |
Target
-
Function
Contributes to histone modification. May position the N-terminus of histone H3 for efficient trimethylation at 'Lys-4'. As part of the MLL1/MLL complex it is involved in methylation and dimethylation at 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. As part of the NSL complex it may be involved in acetylation of nucleosomal histone H4 on several lysine residues. May regulate osteoblasts differentiation. -
Sequence similarities
Belongs to the WD repeat WDR5/wds family.
Contains 7 WD repeats. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 417144 Chicken
- Entrez Gene: 100125836 Cow
- Entrez Gene: 11091 Human
- Entrez Gene: 140858 Mouse
- Entrez Gene: 100156729 Pig
- Entrez Gene: 496891 Xenopus tropicalis
- Omim: 609012 Human
- SwissProt: Q2KIG2 Cow
see all -
Alternative names
- 2410008O07Rik antibody
- AA408785 antibody
- AA960360 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-WDR5 antibody (ab176588)Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse renal cell carcinoma tissue labeling WDR5 with ab176588 at 1/250 dilution. Detection: DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-WDR5 antibody (ab176588)Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human ovarian carcinoma tissue labeling WDR5 with ab176588 at 1/250 dilution. Detection: DAB staining.
Datasheets and documents
References
This product has been referenced in:
- Chen X et al. Upregulated WDR5 promotes proliferation, self-renewal and chemoresistance in bladder cancer via mediating H3K4 trimethylation. Sci Rep 5:8293 (2015). IHC . Read more (PubMed: 25656485) »
