Overview

  • Product name
  • Description
    Rabbit polyclonal to WDR5
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Horse, Chicken, Cow, Dog, Pig, Xenopus laevis, Drosophila melanogaster, Zebrafish, Orangutan, Xenopus tropicalis
  • Immunogen

    Synthetic peptide within Human WDR5 aa 50-100. The exact sequence is proprietary. (NP_060058.1).
    Sequence:

    SVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDS N


    Database link: P61964

  • Positive control
    • Human Breast Carcinoma and Ovarian Carcinoma tissues; mouse renal cell carcinoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab176588 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF 1/50 - 1/500.

Target

  • Function
    Contributes to histone modification. May position the N-terminus of histone H3 for efficient trimethylation at 'Lys-4'. As part of the MLL1/MLL complex it is involved in methylation and dimethylation at 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. As part of the NSL complex it may be involved in acetylation of nucleosomal histone H4 on several lysine residues. May regulate osteoblasts differentiation.
  • Sequence similarities
    Belongs to the WD repeat WDR5/wds family.
    Contains 7 WD repeats.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • 2410008O07Rik antibody
    • AA408785 antibody
    • AA960360 antibody
    • BIG 3 antibody
    • Big antibody
    • BIG3 antibody
    • BMP2 induced 3 kb gene protein antibody
    • BMP2 induced gene, 3-KB antibody
    • BMP2-induced 3-kb gene protein antibody
    • MGC114572 antibody
    • OTTHUMP00000162494 antibody
    • SWD 3 antibody
    • SWD3 antibody
    • SWD3 Set1c WD40 repeat protein homolog antibody
    • WD repeat containing protein 5 antibody
    • WD repeat domain 5 antibody
    • WD repeat protein 5 antibody
    • WD repeat-containing protein 5 antibody
    • WD repeat-containing protein BIG-3 antibody
    • WDR 5 antibody
    • Wdr5 antibody
    • WDR5_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse renal cell carcinoma tissue labeling WDR5 with ab176588 at 1/250 dilution. Detection: DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human ovarian carcinoma tissue labeling WDR5  with ab176588 at 1/250 dilution. Detection: DAB staining.

References

This product has been referenced in:
  • Chen X  et al. Upregulated WDR5 promotes proliferation, self-renewal and chemoresistance in bladder cancer via mediating H3K4 trimethylation. Sci Rep 5:8293 (2015). IHC . Read more (PubMed: 25656485) »
See 1 Publication for this product

Customer reviews and Q&As

Application
IHC - Wholemount
Sample
Xenopus tropicalis Embryo (Epidermis)
Specification
Epidermis

Abcam user community

Verified customer

Submitted May 23 2014

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up