Overview

  • Product name

    Anti-WDR54 antibody
  • Description

    Rabbit polyclonal to WDR54
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human WDR54 aa 1-334.
    Sequence:

    MFRWERSIPLRGSAAALCNNLSVLQLPARNLTYFGVVHGPSAQLLSAAPE GVPLAQRQLHAKEGAGVSPPLITQVHWCVLPFRVLLVLTSHRGIQMYESN GYTMVYWHALDSGDASPVQAVFARGIAASGHFICVGTWSGRVLVFDIPAK GPNIVLSEELAGHQMPITDIATEPAQGQDCVADMVTADDSGLLCVWRSGP EFTLLTRIPGFGVPCPSVQLWQGIIAAGYGNGQVHLYEATTGNLHVQINA HARAICALDLASEVGKLLSAGEDTFVHIWKLSRNPESGYIEVEHCHGECV ADTQLCGARFCDSSGNSFAVTGYDLAEIRRFSSV


    Database link: Q9H977

  • Positive control

    • WB: Mouse stomach lysate. IHC-P: Human lung and stomach tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235315 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Detects a band of approximately 36 kDa (predicted molecular weight: 36 kDa).

Target

Images

  • Anti-WDR54 antibody (ab235315) at 1/1000 dilution + Mouse stomach tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 36 kDa
    Observed band size: 36 kDa

  • Paraffin-embedded human lung tissue stained for WDR54 using ab235315 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human stomach tissue stained for WDR54 using ab235315 at 1/100 dilution in immunohistochemical analysis.

References

ab235315 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235315.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up