Anti-WDR6 antibody (ab243813)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-WDR6 antibody -
Description
Rabbit polyclonal to WDR6 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Cow, Orangutan
-
Immunogen
Recombinant fragment corresponding to Human WDR6 aa 73-149.
Sequence:EPNGDLDLEAMVAVFGSKGLRVVKISWGQGHFWELWRSGLWNMSDWIWDA RWLEGNIALALGHNSVVLYDPVVGCIL
Database link: Q9NNW5 -
Positive control
- IHC-P: Human pancreas tissue. ICC/IF: A431 cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab243813 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100 |
Target
-
Relevance
WDR6 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein is ubiquitously expressed in adult and fetal tissues. -
Database links
- Entrez Gene: 11180 Human
- Omim: 606031 Human
- SwissProt: Q3MIT1 Human
- SwissProt: Q6AZD6 Human
- SwissProt: Q6PKC6 Human
- SwissProt: Q9NNW5 Human
- Unigene: 31387 Human
-
Alternative names
- FLJ10218 antibody
- MGC126756 antibody
- WD repeat domain 6 antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-WDR6 antibody (ab243813)PFA fixed, Triton X-100 permeabilized A431 (Human epidermoid carcinoma cell line) cells labeling WDR6 using ab243813 at 4 µg/ml (green) in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-WDR6 antibody (ab243813)Formalin-fixed, paraffin-embedded human pancreas tissue stained for WDR6 with ab243813 at a 1/50 dilution in immunohistochemical analysis.
Datasheets and documents
References
ab243813 has not yet been referenced specifically in any publications.
