Overview

  • Product name

  • Description

    Rabbit polyclonal to WDR85
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human WDR85 aa 210-325.
    Sequence:

    IVYSGGDDGLLRGWDTRVPGKFLFTSKRHTMGVCSIQSSPHREHILATGS YDEHILLWDTRNMKQPLADTPVQGGVWRIKWHPFHHHLLLAACMHSGFKI LNCQKAMEERQEATVL


    Database link: Q9BTV6

  • Positive control

    • IHC-P: Human breast cancer and human lung tissues. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab234751 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Function

    Plays a role in the first step of diphthamide biosynthesis, a post-translational modification of histidine which occurs in translation elongation factor 2 which can be ADP-ribosylated by diphtheria toxin and by Pseudomonas exotoxin A.
  • Sequence similarities

    Belongs to the WD repeat WDR85 family.
    Contains 3 WD repeats.
  • Information by UniProt
  • Database links

  • Alternative names

    • C9orf112 antibody
    • Diphthamide biosynthesis 7 antibody
    • DPH7 antibody
    • FLJ90634 antibody
    • OTTHUMP00000022705 antibody
    • RP11-48C7.3 antibody
    • RRT2 antibody
    • WD repeat domain 85 antibody
    • WD repeat-containing protein 85 antibody
    • wdr85 antibody
    • WDR85_HUMAN antibody
    see all

Images

  • Paraffin-embedded human lung tissue stained for WDR85 using ab234751 at 1/100 dilution in immunohsitochemical analysis.

  • Paraffin-embedded human breast cancer tissue stained for WDR85 using ab234751 at 1/100 dilution in immunohsitochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells labeling ab234751 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® congugated Goat Anti-Rabbit IgG (H+L).

References

ab234751 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234751.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up