Overview

  • Product name
  • Description
    Mouse polyclonal to WDR9/BRWD1
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    This product was produced with the following immunogens:
    Full length protein corresponding to Human WDR9/BRWD1 aa 1-120.
    Sequence:

    MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPK RLDWEGNEHNRSYEELVLSNKHVAPDHLLQICQRIGPMLDKEIPPSISRV TSLLGAGRQSLLRTAKGTLI


    Database link: Q9NSI6-4

    Full length protein.
    Database link: NP_001007247.1

  • Positive control
    • WDR9/BRWD1 transfected 293T cell lysate; HeLa cells.
  • General notes

     This product was previously labelled as WDR9

     

Properties

Applications

Our Abpromise guarantee covers the use of ab169597 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 14 kDa.
ICC/IF Use a concentration of 10 µg/ml.

Target

  • Function
    May be a transcriptional activator. May be involved in chromatin remodeling.
  • Tissue specificity
    Ubiquitously expressed.
  • Sequence similarities
    Contains 2 bromo domains.
    Contains 8 WD repeats.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • Bromodomain and WD repeat domain containing protein 1 antibody
    • Bromodomain and WD repeat-containing protein 1 antibody
    • Brwd1 antibody
    • BRWD1_HUMAN antibody
    • C21orf107 antibody
    • cAMP response element binding and beta tranducin family antibody
    • FLJ11315 antibody
    • N143 antibody
    • Transcriptional unit N143 antibody
    • WD repeat protein antibody
    • WD repeat-containing protein 9 antibody
    • WDR9 antibody
    see all

Images

  • All lanes : Anti-WDR9/BRWD1 antibody (ab169597) at 1 µg/ml

    Lane 1 : WDR9/BRWD1 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution

    Developed using the ECL technique.

    Predicted band size: 14 kDa

References

ab169597 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169597.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up