Overview

  • Product name

    Anti-WFDC8 antibody
  • Description

    Rabbit polyclonal to WFDC8
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human WFDC8 aa 44-94.
    Sequence:

    KHKPGLCPKERLTCTTELPDSCNTDFDCKEYQKCCFFACQKKCMDPFQEP


    Database link: Q8IUA0

  • Positive control

    • IHC-P: Human prostate cancer tissue. Human testicular tissue. ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab229922 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Cellular localization

    Secreted
  • Database links

  • Alternative names

    • C20orf170 antibody
    • dJ461P17.1 antibody
    • Putative protease inhibitor WAP8 antibody
    • WAP four-disulfide core domain 8 antibody
    • WAP8 antibody
    see all

Images

  • HepG2 (Human liver hepatocellular carcinoma cell line) cells stained for WFDC8 using ab229922 at a dilution of 1/100 in ICC/IF. Secondary used is an Alexa Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human testicular tissue stained for WFDC8 with ab229922 at a 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human prostate cancer tissue stained for WFDC8 with ab229922 at a 1/100 dilution in immunohistochemical analysis.

References

ab229922 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229922.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up