Overview

  • Product name

  • Description

    Rabbit polyclonal to WFS1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human WFS1 aa 762-867.
    Sequence:

    KHPCHIKKFDRYKFEITVGMPFSSGADGSRSREEDDVTKDIVLRASSEFK SVLLSLRQGSLIEFSTILEGRLGSKWPVFELKAISCLNCMAQLSPTRRHV KIEHDW


    Database link: O76024

  • Positive control

    • IHC-P: Human heart muscle tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224767 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    WFS1 is a novel component of Wolfram syndrome, a rare form of juvenile diabetes. WFS1 plays an important role in maintaining homeostasis of the endoplasmic reticulum (ER) in the pancreas. It is normally up-regulated during insulin secretion, whereas inactivation of the protein can cause ER stress. Chronic ER stress is a major involvement in Wolfram syndrome.
  • Cellular localization

    Endoplasmic reticulum; endoplasmic reticulum membrane; multipass membrane protein
  • Database links

  • Alternative names

    • CTRCT41 antibody
    • DFNA14 antibody
    • DFNA38 antibody
    • DFNA6 antibody
    • DIDMOAD antibody
    • WFRS antibody
    • WFS antibody
    • WFSL antibody
    • Wolfram syndrome 1 (wolframin) antibody
    • Wolfram syndrome antibody
    • WOLFRAMIN antibody
    • wolframin ER transmembrane glycoprotein antibody
    see all

Images

  • Paraffin-embedded human heart muscle tissue stained for WFS1 using ab224767 at 1/200 dilution in immunohistochemical analysis.

References

ab224767 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224767.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up