Overview

  • Product name

  • Description

    Rabbit polyclonal to WHSC1/NSD2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human WHSC1/NSD2 aa 30-146.
    Sequence:

    SANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKL KDLTSRVFNGEPGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKIT KTYMNGKPLFESSICGD


    Database link: O96028

  • Positive control

    • IHC-P: Human oral mucosa tissue. ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab223694 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Probable histone methyltransferase (By similarity). May act as a transcription regulator that binds DNA and suppresses IL5 transcription.
  • Tissue specificity

    Widely expressed.
  • Involvement in disease

    Note=A chromosomal aberration involving WHSC1 is a cause of multiple myeloma tumors. Translocation t(4;14)(p16.3;q32.3) with IgH.
    Note=WHSC1 is located in the Wolf-Hirschhorn syndrome (WHS) critical region. WHS results from by sub-telomeric deletions in the short arm of chromosome 4. WHSC1 is deleted in every case, however deletion of linked genes contributes to both the severity of the core characteristics and the presence of the additional syndromic problems.
  • Sequence similarities

    Belongs to the histone-lysine methyltransferase family. SET2 subfamily.
    Contains 1 AWS domain.
    Contains 1 HMG box DNA-binding domain.
    Contains 4 PHD-type zinc fingers.
    Contains 1 post-SET domain.
    Contains 2 PWWP domains.
    Contains 1 SET domain.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasm and Nucleus. Chromosome.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ23286 antibody
    • IL5 promoter REII region binding protein antibody
    • KIAA1090 antibody
    • MGC176638 antibody
    • MMSET antibody
    • MMSET type II antibody
    • Multiple myeloma SET domain containing protein type III antibody
    • Multiple myeloma SET domain protein antibody
    • Multiple myeloma SET domain-containing protein antibody
    • NSD 2 antibody
    • NSD2 antibody
    • NSD2_HUMAN antibody
    • Nuclear receptor binding SET domain protein 2 antibody
    • Nuclear SET domain-containing protein 2 antibody
    • Probable histone-lysine N-methyltransferase NSD2 antibody
    • Protein trithorax-5 antibody
    • REIIBP antibody
    • Trithorax/ash1 related protein 5 antibody
    • TRX5 antibody
    • TRX5 protein antibody
    • WHS antibody
    • Whsc1 antibody
    • Wolf Hirschhorn syndrome candidate 1 antibody
    • Wolf Hirschhorn syndrome candidate 1 protein antibody
    • Wolf-Hirschhorn syndrome candidate 1 protein antibody
    see all

Images

  • Paraffin-embedded human oral mucosa tissue stained for WHSC1/NSD2 using ab223694 at 1/50 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for WHSC1/NSD2 (green) using ab223694 at 4 µg/ml in ICC/IF.

References

ab223694 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223694.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up