Anti-WHSC2/NELF-A antibody (ab167675)
Key features and details
- Mouse polyclonal to WHSC2/NELF-A
- Suitable for: WB, ICC/IF
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-WHSC2/NELF-A antibody
See all WHSC2/NELF-A primary antibodies -
Description
Mouse polyclonal to WHSC2/NELF-A -
Host species
Mouse -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Recombinant full length protein corresponding to Human WHSC2/NELF-A aa 1-528. (NP_005654.2)
Sequence:MASMRESDTGLWLHNKLGATDELWAPPSIASLLTAAVIDNIRLCFHGLSS AVKLKLLLGTLHLPRRTVDEMKGALMEIIQLASLDSDPWVLMVADILKSF PDTGSLNLELEEQNPNVQDILGELREKVGECEASAMLPLECQYLNKNALT TLAGPLTPPVKHFQLKRKPKSATLRAELLQKSTETAQQLKRSAGVPFHAK GRGLLRKMDTTTPLKGIPKQAPFRSPTAPSVFSPTGNRTPIPPSRTLLRK ERGVKLLDISELDMVGAGREAKRRRKTLDAEVVEKPAKEETVVENATPDY AAGLVSTQKLGSLNNEPALPSTSYLPSTPSVVPASSYIPSSETPPAPSSR EASRPPEEPSAPSPTLPAQFKQRAPMYNSGLSPATPTPAAPTSPLTPTTP PAVAPTTQTPPVAMVAPQTQAPAQQQPKKNLSLTREQMFAAQEMFKTANK VTRPEKALILGFMAGSRENPCQEQGDVIQIKLSEHTEDLPKADGQGSTTM LVDTVFEMNYATGQWTRFKKYKPMTNVS
-
Positive control
- WHSC2/NELF-A transfected 293T cell lysate; HeLa cell nuclear extract, Raw 264.7, NIH/3T3 cell lysate; HeLa cells
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. -
Storage buffer
pH: 7.4
Constituent: 99% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab167675 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
Use a concentration of 1 µg/ml. Predicted molecular weight: 57 kDa.
|
|
ICC/IF |
Use a concentration of 10 µg/ml.
|
Notes |
---|
WB
Use a concentration of 1 µg/ml. Predicted molecular weight: 57 kDa. |
ICC/IF
Use a concentration of 10 µg/ml. |
Target
-
Function
Essential component of the NELF complex, a complex that negatively regulates the elongation of transcription by RNA polymerase II. The NELF complex, which acts via an association with the DSIF complex and causes transcriptional pausing, is counteracted by the P-TEFb kinase complex. Probably required to interact with the RNA polymerase II complex. -
Tissue specificity
Ubiquitous. Expressed in heart, brain, placenta, liver, skeletal muscle, kidney and pancreas. Expressed at lower level in adult lung. Expressed in fetal brain, lung, liver and kidney. -
Sequence similarities
Belongs to the NELF-A family.
Contains 1 HDAg-like domain. -
Domain
The HDAg-like domain is essential for transcriptional repression, and mediates the interaction with the RNA polymerase II complex. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 7469 Human
- Entrez Gene: 24116 Mouse
- Omim: 606026 Human
- SwissProt: Q9H3P2 Human
- SwissProt: Q8BG30 Mouse
- Unigene: 21771 Human
- Unigene: 332320 Mouse
-
Alternative names
- FLJ10442 antibody
- FLJ25112 antibody
- Negative elongation factor A antibody
see all
Images
-
All lanes : Anti-WHSC2/NELF-A antibody (ab167675) at 1 µg/ml
Lane 1 : WHSC2/NELF-A transfected 293T cell lysate
Lane 2 : Non-transfected 293T cell lysate
Lysates/proteins at 15 µl per lane.
Developed using the ECL technique.
Predicted band size: 57 kDa -
Anti-WHSC2/NELF-A antibody (ab167675) at 1/500 dilution + HeLa cell nuclear extract at 50 µg
Developed using the ECL technique.
Predicted band size: 57 kDa -
Anti-WHSC2/NELF-A antibody (ab167675) at 1/500 dilution + Raw 264.7 cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 57 kDa -
Anti-WHSC2/NELF-A antibody (ab167675) at 1/500 dilution + NIH/3T3 cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 57 kDa -
Immunofluorescence analysis of HeLa cells, labeling WHSC2/NELF-A with ab167675 at 10 µg/ml.
Protocols
Datasheets and documents
-
Datasheet download
References (1)
ab167675 has been referenced in 1 publication.
- Abe K et al. Distinct patterns of RNA polymerase II and transcriptional elongation characterize mammalian genome activation. Cell Rep 41:111865 (2022). PubMed: 36577375