Overview

  • Product name

    Anti-WHSC2/NELF-A antibody
    See all WHSC2/NELF-A primary antibodies
  • Description

    Mouse polyclonal to WHSC2/NELF-A
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human WHSC2/NELF-A aa 1-528. (NP_005654.2)
    Sequence:

    MASMRESDTGLWLHNKLGATDELWAPPSIASLLTAAVIDNIRLCFHGLSS AVKLKLLLGTLHLPRRTVDEMKGALMEIIQLASLDSDPWVLMVADILKSF PDTGSLNLELEEQNPNVQDILGELREKVGECEASAMLPLECQYLNKNALT TLAGPLTPPVKHFQLKRKPKSATLRAELLQKSTETAQQLKRSAGVPFHAK GRGLLRKMDTTTPLKGIPKQAPFRSPTAPSVFSPTGNRTPIPPSRTLLRK ERGVKLLDISELDMVGAGREAKRRRKTLDAEVVEKPAKEETVVENATPDY AAGLVSTQKLGSLNNEPALPSTSYLPSTPSVVPASSYIPSSETPPAPSSR EASRPPEEPSAPSPTLPAQFKQRAPMYNSGLSPATPTPAAPTSPLTPTTP PAVAPTTQTPPVAMVAPQTQAPAQQQPKKNLSLTREQMFAAQEMFKTANK VTRPEKALILGFMAGSRENPCQEQGDVIQIKLSEHTEDLPKADGQGSTTM LVDTVFEMNYATGQWTRFKKYKPMTNVS

  • Positive control

    • WHSC2/NELF-A transfected 293T cell lysate; HeLa cell nuclear extract, Raw 264.7, NIH/3T3 cell lysate; HeLa cells
  • General notes

    Protein previously labeled as WHSC2. 

Properties

Applications

Our Abpromise guarantee covers the use of ab167675 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 57 kDa.
ICC/IF Use a concentration of 10 µg/ml.

Target

  • Function

    Essential component of the NELF complex, a complex that negatively regulates the elongation of transcription by RNA polymerase II. The NELF complex, which acts via an association with the DSIF complex and causes transcriptional pausing, is counteracted by the P-TEFb kinase complex. Probably required to interact with the RNA polymerase II complex.
  • Tissue specificity

    Ubiquitous. Expressed in heart, brain, placenta, liver, skeletal muscle, kidney and pancreas. Expressed at lower level in adult lung. Expressed in fetal brain, lung, liver and kidney.
  • Sequence similarities

    Belongs to the NELF-A family.
    Contains 1 HDAg-like domain.
  • Domain

    The HDAg-like domain is essential for transcriptional repression, and mediates the interaction with the RNA polymerase II complex.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ10442 antibody
    • FLJ25112 antibody
    • Negative elongation factor A antibody
    • Negative elongation factor polypeptide A antibody
    • NELF A antibody
    • NELF-A antibody
    • NELFA antibody
    • NELFA_HUMAN antibody
    • P/OKcl.15 antibody
    • P/OKcl15 antibody
    • WHSC 2 antibody
    • Whsc2 antibody
    • Wolf Hirschhorn syndrome candidate 2 antibody
    • Wolf Hirschhorn syndrome candidate 2 protein antibody
    • Wolf-Hirschhorn syndrome candidate 2 protein antibody
    see all

Images

  • All lanes : Anti-WHSC2/NELF-A antibody (ab167675) at 1 µg/ml

    Lane 1 : WHSC2/NELF-A transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Developed using the ECL technique.

    Predicted band size: 57 kDa

  • Anti-WHSC2/NELF-A antibody (ab167675) at 1/500 dilution + HeLa cell nuclear extract at 50 µg

    Developed using the ECL technique.

    Predicted band size: 57 kDa

  • Anti-WHSC2/NELF-A antibody (ab167675) at 1/500 dilution + Raw 264.7 cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 57 kDa

  • Anti-WHSC2/NELF-A antibody (ab167675) at 1/500 dilution + NIH/3T3 cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 57 kDa

  • Immunofluorescence analysis of HeLa cells, labeling WHSC2/NELF-A with ab167675 at 10 µg/ml.

References

ab167675 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167675.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up